(data stored in ACNUC7421 zone)

EMBL: CP000821.PE316

CP000821.PE316       Location/Qualifiers
FT   CDS             complement(367983..370397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0316"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shm:Shewmr7_3685 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34929"
FT                   /db_xref="GOA:A8FQ06"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ06"
FT                   /protein_id="ABV34929.1"
FT                   /translation="MIDKLALRLSQYPARLKFALWVMLLCITTLTGIQLWQGGAKIQSD
FT                   ILAMLPKLKEDPLTETALARVEEQLSNTVYIALLAEDKSQAVTAANTLIESLSSDNRDA
FT                   FVDIRSADLNQAQALNHFYFNHRFNLLTQAQASALSSGKLSELLRQAQLQLYNAFGYAN
FT                   SGLIANDPLLLYPDNLQALAPKQRLQVQQGILLGQWSPNETDESSKPAAKVAAIVMAKG
FT                   LGSAFNPNTQELQMAVLQEAFETVESQNKQVAFLKAGALFHASAATKSAKSEVSTLGLA
FT                   SLIGVSLLVWLAFRSVMPLGIALLTITTSLLTAVVMTLLIFSELHLLTLVFGTSLIGIA
FT                   IDYNFHFYCERLAQAEKSANEIIRKIFPAITLALLTSVLAYSGIGLAPFPGMQQVAVFC
FT                   AAGLFGAYITLSLAYPLLASGPLPSGEKPLSMAAAYLTKLNSISRFLNYKIGGVLLALS
FT                   VIISAFGLYQLTSDDDIRNLQQSPESVSDEEQQLRGILSGGTDNQFLLVRGETEEQLLQ
FT                   RLEILSPKLNNAVEKGLIGNAFSLSTYLPSRSKQEDNYQLQGLIYQQNLASIVENLGLD
FT                   DSLISDLAEAYQKAKGSYIDAESFISSDAGKLFKPLWITPTPLQDQYGAIVLLGGITEI
FT                   DKLESFFSKLSYVQLVDRVGEISGVMGQYRQLTLWLLAIAMAIAALIFSTRFGIKLAAL
FT                   VVAVPALSAVLTLSLLGLIGAPLTLFHALALILVFGIGVDYSLFFAESKHQSRGVMMAV
FT                   FMSASSTILAFGLLAFSSTPAIHSFGLTLLLGIGFTFALSPFIQTFTRTFK"
     MIDKLALRLS QYPARLKFAL WVMLLCITTL TGIQLWQGGA KIQSDILAML PKLKEDPLTE        60
     TALARVEEQL SNTVYIALLA EDKSQAVTAA NTLIESLSSD NRDAFVDIRS ADLNQAQALN       120
     HFYFNHRFNL LTQAQASALS SGKLSELLRQ AQLQLYNAFG YANSGLIAND PLLLYPDNLQ       180
     ALAPKQRLQV QQGILLGQWS PNETDESSKP AAKVAAIVMA KGLGSAFNPN TQELQMAVLQ       240
     EAFETVESQN KQVAFLKAGA LFHASAATKS AKSEVSTLGL ASLIGVSLLV WLAFRSVMPL       300
     GIALLTITTS LLTAVVMTLL IFSELHLLTL VFGTSLIGIA IDYNFHFYCE RLAQAEKSAN       360
     EIIRKIFPAI TLALLTSVLA YSGIGLAPFP GMQQVAVFCA AGLFGAYITL SLAYPLLASG       420
     PLPSGEKPLS MAAAYLTKLN SISRFLNYKI GGVLLALSVI ISAFGLYQLT SDDDIRNLQQ       480
     SPESVSDEEQ QLRGILSGGT DNQFLLVRGE TEEQLLQRLE ILSPKLNNAV EKGLIGNAFS       540
     LSTYLPSRSK QEDNYQLQGL IYQQNLASIV ENLGLDDSLI SDLAEAYQKA KGSYIDAESF       600
     ISSDAGKLFK PLWITPTPLQ DQYGAIVLLG GITEIDKLES FFSKLSYVQL VDRVGEISGV       660
     MGQYRQLTLW LLAIAMAIAA LIFSTRFGIK LAALVVAVPA LSAVLTLSLL GLIGAPLTLF       720
     HALALILVFG IGVDYSLFFA ESKHQSRGVM MAVFMSASST ILAFGLLAFS STPAIHSFGL       780
     TLLLGIGFTF ALSPFIQTFT RTFK                                              804
//

If you have problems or comments...

PBIL Back to PBIL home page