(data stored in ACNUC7421 zone)

EMBL: CP000821.PE317

CP000821.PE317       Location/Qualifiers
FT   CDS             complement(370394..371197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0317"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shm:Shewmr7_3684 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34930"
FT                   /db_xref="GOA:A8FQ07"
FT                   /db_xref="InterPro:IPR004564"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ07"
FT                   /protein_id="ABV34930.1"
FT                   /translation="MKTRERSYSTWFATGLSRGKSVFGLLLLLSLSTFNVHATQSSNYD
FT                   TLFESSADNKRLQALADRLMIGESASGSFTQYRTLKVLKKPLISHGHFIFDSRLGLVWQ
FT                   QTQPFETTLILKEGELIQIDSAGRRQVSQAGSNQGAAAIAQTMPKLLSALLSGNLSDLS
FT                   EHFNLYLKADDTRNEPQEDEPAHWQLGLIPKDPLLVKAIPQMVLEGGEQVSALILLSNS
FT                   GDSSRIEFEQISKAPLSQEQRLFLSDRQGEDSPKVQPEAKPEPYP"
     MKTRERSYST WFATGLSRGK SVFGLLLLLS LSTFNVHATQ SSNYDTLFES SADNKRLQAL        60
     ADRLMIGESA SGSFTQYRTL KVLKKPLISH GHFIFDSRLG LVWQQTQPFE TTLILKEGEL       120
     IQIDSAGRRQ VSQAGSNQGA AAIAQTMPKL LSALLSGNLS DLSEHFNLYL KADDTRNEPQ       180
     EDEPAHWQLG LIPKDPLLVK AIPQMVLEGG EQVSALILLS NSGDSSRIEF EQISKAPLSQ       240
     EQRLFLSDRQ GEDSPKVQPE AKPEPYP                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page