(data stored in ACNUC7421 zone)

EMBL: CP000821.PE318

CP000821.PE318       Location/Qualifiers
FT   CDS             complement(371194..371673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0318"
FT                   /product="thioesterase superfamily protein"
FT                   /note="KEGG: slo:Shew_3518 thioesterase superfamily
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34931"
FT                   /db_xref="GOA:A8FQ08"
FT                   /db_xref="InterPro:IPR006684"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ08"
FT                   /protein_id="ABV34931.1"
FT                   /translation="MTKLSGKAILTIELEMLIPFHDVDSMGITWHGNYLRYFEIARCQL
FT                   LDKIQYGYREMQASGYSWPIVDLQIKYVQPSTFEQKIKVIASLVEWENRIKINYQVRDV
FT                   VTNQRLTKGYTIQAAVETETNELCFVTPDIFREKIAHLIEKHASQNPVVSEGSGR"
     MTKLSGKAIL TIELEMLIPF HDVDSMGITW HGNYLRYFEI ARCQLLDKIQ YGYREMQASG        60
     YSWPIVDLQI KYVQPSTFEQ KIKVIASLVE WENRIKINYQ VRDVVTNQRL TKGYTIQAAV       120
     ETETNELCFV TPDIFREKIA HLIEKHASQN PVVSEGSGR                              159
//

If you have problems or comments...

PBIL Back to PBIL home page