(data stored in ACNUC7421 zone)

EMBL: CP000821.PE32

CP000821.PE32        Location/Qualifiers
FT   CDS             complement(38087..39496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0032"
FT                   /product="TrkA-N domain protein"
FT                   /note="KEGG: slo:Shew_3739 TrkA-N domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34645"
FT                   /db_xref="GOA:A8FP72"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006036"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:A8FP72"
FT                   /protein_id="ABV34645.1"
FT                   /translation="MKIIILGAGQVGGTLAENLVGENNDITIVDNDRSRLRSLQDKYDL
FT                   RVVFGHGAHPNVLKEAGAEDADMLIAVTNSDECNMSACQMAYTLFGTPTKIARIRSEQY
FT                   LALRDKLFINTETKKNDNSPRGGFIIDELIAPEQLVTAYIRRLVEYPGALQVLEFAEGR
FT                   LSLVAVRAYYGGPLVGNALAALREHMPNIDTRVAAIFRQGRPIMPRGTTIIEADDEVFF
FT                   VADSRHVRAVMSEMQKLDNSYRNIMIAGGGNIGFGLAQQLQRNHSVKLIEHRQERAEEL
FT                   SEKLENTTVFCGDASDQELLLEEHIDQTDVFIAVTNDDEANIMAALLAKRMGAKKVMVL
FT                   IQREAYVDIVQEANIDIAISPQQATISALLTHIRQGDICNVYSLRRGAAEAIEAIAHGD
FT                   SKTSKVVGKQIGNIKLPPGTTIGAIVRDEEVLMAHDKTVIEQGDHVILFLVNKKFIGEV
FT                   EKLFQPSAFFF"
     MKIIILGAGQ VGGTLAENLV GENNDITIVD NDRSRLRSLQ DKYDLRVVFG HGAHPNVLKE        60
     AGAEDADMLI AVTNSDECNM SACQMAYTLF GTPTKIARIR SEQYLALRDK LFINTETKKN       120
     DNSPRGGFII DELIAPEQLV TAYIRRLVEY PGALQVLEFA EGRLSLVAVR AYYGGPLVGN       180
     ALAALREHMP NIDTRVAAIF RQGRPIMPRG TTIIEADDEV FFVADSRHVR AVMSEMQKLD       240
     NSYRNIMIAG GGNIGFGLAQ QLQRNHSVKL IEHRQERAEE LSEKLENTTV FCGDASDQEL       300
     LLEEHIDQTD VFIAVTNDDE ANIMAALLAK RMGAKKVMVL IQREAYVDIV QEANIDIAIS       360
     PQQATISALL THIRQGDICN VYSLRRGAAE AIEAIAHGDS KTSKVVGKQI GNIKLPPGTT       420
     IGAIVRDEEV LMAHDKTVIE QGDHVILFLV NKKFIGEVEK LFQPSAFFF                   469
//

If you have problems or comments...

PBIL Back to PBIL home page