(data stored in ACNUC7421 zone)

EMBL: CP000821.PE321

CP000821.PE321       Location/Qualifiers
FT   CDS             complement(374936..375313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0321"
FT                   /product="thioester dehydrase family protein"
FT                   /note="KEGG: shn:Shewana3_0337 thioester dehydrase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34934"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR016962"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ11"
FT                   /protein_id="ABV34934.1"
FT                   /translation="MIKSKLPRVLSTDIQVEAVEWRIFIDADLPFFDGHFPEQAVLPGV
FT                   TQLDWAIRMGCEYFNYPADVATLEVLKFQQLMLPNSEVSLKISQNSSKTKLLFSYFDDE
FT                   KRFASGRILLASPALADIENS"
     MIKSKLPRVL STDIQVEAVE WRIFIDADLP FFDGHFPEQA VLPGVTQLDW AIRMGCEYFN        60
     YPADVATLEV LKFQQLMLPN SEVSLKISQN SSKTKLLFSY FDDEKRFASG RILLASPALA       120
     DIENS                                                                   125
//

If you have problems or comments...

PBIL Back to PBIL home page