(data stored in ACNUC7421 zone)

EMBL: CP000821.PE322

CP000821.PE322       Location/Qualifiers
FT   CDS             complement(375306..376670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0322"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_3514 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34935"
FT                   /db_xref="GOA:A8FQ12"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ12"
FT                   /protein_id="ABV34935.1"
FT                   /translation="MTELLKSWLSKGPSSQQLISFNHHDIVNGAAFTSQVTNIHQQLIQ
FT                   SKSQRWLLACESSDLFAVGLCAALLAGKEIILPSNTQTGTLSEITHEFDGVISDQPLCE
FT                   GKTFIMLKRDLHETNNVWPKCDNYGKLVLFTSGSSGHPKAVCKTLEQLDAEVSILENTF
FT                   AKHLPHCSVISTVSHQHIYGLLFKILWPLAASRPFLSDIVEYPETLTYYTSLFPNLCLI
FT                   SSPAQLSRLPESLDNERQLRSPSLVFSSGGPLNFEAAQGIAHCYGRQPIEVFGSTETGG
FT                   VAYRRQTQQDQAWRVFDSIDIRQDDKDGALLLKSPYLENDKWLRCEDKITLLKPGEFQL
FT                   QGRLDRVVKIEEKRLSLVQMEALLESHPLVSQAALLVLDQPRTQLGAVIELSQQGKEQL
FT                   DTEGKLSLNNLFKAHLLTQFERVTLPRRWRYPETVPVNSQGKRLANQLSELFEHD"
     MTELLKSWLS KGPSSQQLIS FNHHDIVNGA AFTSQVTNIH QQLIQSKSQR WLLACESSDL        60
     FAVGLCAALL AGKEIILPSN TQTGTLSEIT HEFDGVISDQ PLCEGKTFIM LKRDLHETNN       120
     VWPKCDNYGK LVLFTSGSSG HPKAVCKTLE QLDAEVSILE NTFAKHLPHC SVISTVSHQH       180
     IYGLLFKILW PLAASRPFLS DIVEYPETLT YYTSLFPNLC LISSPAQLSR LPESLDNERQ       240
     LRSPSLVFSS GGPLNFEAAQ GIAHCYGRQP IEVFGSTETG GVAYRRQTQQ DQAWRVFDSI       300
     DIRQDDKDGA LLLKSPYLEN DKWLRCEDKI TLLKPGEFQL QGRLDRVVKI EEKRLSLVQM       360
     EALLESHPLV SQAALLVLDQ PRTQLGAVIE LSQQGKEQLD TEGKLSLNNL FKAHLLTQFE       420
     RVTLPRRWRY PETVPVNSQG KRLANQLSEL FEHD                                   454
//

If you have problems or comments...

PBIL Back to PBIL home page