(data stored in ACNUC7421 zone)

EMBL: CP000821.PE323

CP000821.PE323       Location/Qualifiers
FT   CDS             complement(376667..377215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0323"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_3513 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34936"
FT                   /db_xref="GOA:A8FQ13"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ13"
FT                   /protein_id="ABV34936.1"
FT                   /translation="MRLFLQIVTSLLLIGYPLAVYFGLNYLPAGTIAMVLCLFLILRLL
FT                   IQKQQVKSMVLPVLVGIGLTAGSFIAKRHDWLLYYPVVINLSMLLLFGYSLKSGPSMIE
FT                   RLARLKEPDLPDEAIPYLQKVTLIWCGLFVFNGVVALYTARYSSLEIWTLYNGLIAYLL
FT                   IGSLLGGEWLYRTIWLKKS"
     MRLFLQIVTS LLLIGYPLAV YFGLNYLPAG TIAMVLCLFL ILRLLIQKQQ VKSMVLPVLV        60
     GIGLTAGSFI AKRHDWLLYY PVVINLSMLL LFGYSLKSGP SMIERLARLK EPDLPDEAIP       120
     YLQKVTLIWC GLFVFNGVVA LYTARYSSLE IWTLYNGLIA YLLIGSLLGG EWLYRTIWLK       180
     KS                                                                      182
//

If you have problems or comments...

PBIL Back to PBIL home page