(data stored in ACNUC7421 zone)

EMBL: CP000821.PE325

CP000821.PE325       Location/Qualifiers
FT   CDS             complement(377472..377726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0325"
FT                   /product="acyl carrier protein, putative"
FT                   /note="KEGG: shn:Shewana3_0344 acyl carrier protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34938"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ15"
FT                   /protein_id="ABV34938.1"
FT                   /translation="MSLHNEIKQLIIDCLDLEDVSIDDIETDAALFGEGLGLDSIDALE
FT                   LGLAIKKRFDVKIEANSEATKAHFYSVANLASFIESQRA"
     MSLHNEIKQL IIDCLDLEDV SIDDIETDAA LFGEGLGLDS IDALELGLAI KKRFDVKIEA        60
     NSEATKAHFY SVANLASFIE SQRA                                               84
//

If you have problems or comments...

PBIL Back to PBIL home page