(data stored in ACNUC7421 zone)

EMBL: CP000821.PE327

CP000821.PE327       Location/Qualifiers
FT   CDS             complement(378514..379230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0327"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO4366 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34940"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ17"
FT                   /protein_id="ABV34940.1"
FT                   /translation="MQLLFTICSWGAWSPRCQQASDWKRWPETKLAHDSDLPRAPKLAQ
FT                   VPAMQRRRYSALTKMQLEAAFQCDAPQQCRTIFSSRHGELNRTIGLLDNVVNREALSPT
FT                   AFSQSVHNTASGIYSILKGNRSASTSIAAGSETLYQALVEAYAQLHEDPTPLLFVFGDE
FT                   PVPQVYSQFTDEPELPLSMAFVLTLTAPEPGQPQLTIGNLTSADDLSYGELLHSLATKQ
FT                   PTSGTLSKHHWQLSFG"
     MQLLFTICSW GAWSPRCQQA SDWKRWPETK LAHDSDLPRA PKLAQVPAMQ RRRYSALTKM        60
     QLEAAFQCDA PQQCRTIFSS RHGELNRTIG LLDNVVNREA LSPTAFSQSV HNTASGIYSI       120
     LKGNRSASTS IAAGSETLYQ ALVEAYAQLH EDPTPLLFVF GDEPVPQVYS QFTDEPELPL       180
     SMAFVLTLTA PEPGQPQLTI GNLTSADDLS YGELLHSLAT KQPTSGTLSK HHWQLSFG         238
//

If you have problems or comments...

PBIL Back to PBIL home page