(data stored in ACNUC7421 zone)

EMBL: CP000821.PE328

CP000821.PE328       Location/Qualifiers
FT   CDS             complement(379475..380344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0328"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_3508 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34941"
FT                   /db_xref="GOA:A8FQ18"
FT                   /db_xref="InterPro:IPR021382"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ18"
FT                   /protein_id="ABV34941.1"
FT                   /translation="MQVSQEDRIAPQEKSAGANTIAIVALAVVVLISGGAYYYFSDTAE
FT                   LQPQERAAVEIPDVLPEEPLVTIADIPEPEIEAVVEPVIEVVETPQPEIEPLPTLEESD
FT                   SFVHDKTVVMADGMAIEPMLVEKDLVRHFVVFVDNLAQGELARKVSPLKGPERVFTVSE
FT                   ITNKTYLNPDSYHRYDLYADFVANLNEVQLADTYKELTPLLSEAFEELGYGDMSFNERM
FT                   LEAIDIMLAAPIIEQPIELDGVSVNYQFVDPQLEALPNAQKLLVRMGPENSKKVKAALR
FT                   RLKKHLAD"
     MQVSQEDRIA PQEKSAGANT IAIVALAVVV LISGGAYYYF SDTAELQPQE RAAVEIPDVL        60
     PEEPLVTIAD IPEPEIEAVV EPVIEVVETP QPEIEPLPTL EESDSFVHDK TVVMADGMAI       120
     EPMLVEKDLV RHFVVFVDNL AQGELARKVS PLKGPERVFT VSEITNKTYL NPDSYHRYDL       180
     YADFVANLNE VQLADTYKEL TPLLSEAFEE LGYGDMSFNE RMLEAIDIML AAPIIEQPIE       240
     LDGVSVNYQF VDPQLEALPN AQKLLVRMGP ENSKKVKAAL RRLKKHLAD                   289
//

If you have problems or comments...

PBIL Back to PBIL home page