(data stored in ACNUC7421 zone)

EMBL: CP000821.PE33

CP000821.PE33        Location/Qualifiers
FT   CDS             complement(39506..40786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0033"
FT                   /product="sun protein"
FT                   /note="KEGG: slo:Shew_3738 sun protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34646"
FT                   /db_xref="GOA:A8FP73"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR004573"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR018314"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:A8FP73"
FT                   /protein_id="ABV34646.1"
FT                   /translation="MNLRALAAKVVFQVLEKGISLSVALPDQQRHLESGKDKALMAELC
FT                   YGVMRHLPQLDKLVSDCMSKPLKGKQRILHQLLLVGCYQLYFTRIPSHAAISETAEACR
FT                   QLKFEGLVKVVNGVLRNIQRQEKPLPTDNETLALNTPAWIIKRLKAAYPESWKEIVEQS
FT                   HQRPPMWLRSNKLSQTRDEYLASLAEVEIQASAGKSSDAILLESPKDVLQLPGFEEGTA
FT                   SVQDGAAQWAATLLAPIDGELVLDACAAPGGKTCHLLEQAPNIELVAVDFDANRLERVQ
FT                   QNLDRLSLNAKLIHGDAADIDSWWQGDKFDRILLDAPCSATGVIRRHPDIKWLRKQADI
FT                   EELASLQSKILDHCWQWLKPGGTLLYATCSILPQENEQQIRAFLERANDATLVPIDEQN
FT                   HPDDIGWQITPGLENMDGFYYARLVKG"
     MNLRALAAKV VFQVLEKGIS LSVALPDQQR HLESGKDKAL MAELCYGVMR HLPQLDKLVS        60
     DCMSKPLKGK QRILHQLLLV GCYQLYFTRI PSHAAISETA EACRQLKFEG LVKVVNGVLR       120
     NIQRQEKPLP TDNETLALNT PAWIIKRLKA AYPESWKEIV EQSHQRPPMW LRSNKLSQTR       180
     DEYLASLAEV EIQASAGKSS DAILLESPKD VLQLPGFEEG TASVQDGAAQ WAATLLAPID       240
     GELVLDACAA PGGKTCHLLE QAPNIELVAV DFDANRLERV QQNLDRLSLN AKLIHGDAAD       300
     IDSWWQGDKF DRILLDAPCS ATGVIRRHPD IKWLRKQADI EELASLQSKI LDHCWQWLKP       360
     GGTLLYATCS ILPQENEQQI RAFLERANDA TLVPIDEQNH PDDIGWQITP GLENMDGFYY       420
     ARLVKG                                                                  426
//

If you have problems or comments...

PBIL Back to PBIL home page