(data stored in ACNUC7421 zone)

EMBL: CP000821.PE335

CP000821.PE335       Location/Qualifiers
FT   CDS             complement(389159..389443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0335"
FT                   /product="DNA-directed RNA polymerase, omega subunit"
FT                   /note="KEGG: slo:Shew_3498 DNA-directed RNA polymerase,
FT                   omega subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34948"
FT                   /db_xref="GOA:A8FQ25"
FT                   /db_xref="InterPro:IPR003716"
FT                   /db_xref="InterPro:IPR006110"
FT                   /db_xref="InterPro:IPR012293"
FT                   /db_xref="InterPro:IPR036161"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8FQ25"
FT                   /protein_id="ABV34948.1"
FT                   /translation="MARVTVEDAVNQIGNRFDMILVAARRARQIAVQGKDPMVEEENDK
FT                   PTVIALREIELGLVTADTLDADERQTVREREAAEIAAVAAIAEGRNNVI"
     MARVTVEDAV NQIGNRFDMI LVAARRARQI AVQGKDPMVE EENDKPTVIA LREIELGLVT        60
     ADTLDADERQ TVREREAAEI AAVAAIAEGR NNVI                                    94
//

If you have problems or comments...

PBIL Back to PBIL home page