(data stored in ACNUC7421 zone)

EMBL: CP000821.PE336

CP000821.PE336       Location/Qualifiers
FT   CDS             complement(389500..390123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0336"
FT                   /product="Guanylate kinase"
FT                   /EC_number="2.7.4.8"
FT                   /note="KEGG: shm:Shewmr7_0330 guanylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34949"
FT                   /db_xref="GOA:A8FQ26"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR017665"
FT                   /db_xref="InterPro:IPR020590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ26"
FT                   /protein_id="ABV34949.1"
FT                   /translation="MTARGNLFIVSAPSGAGKSSLISALLKDKPTDKQVSVSHTTRQPR
FT                   PGEVNGQHYHFVTVEEFKALIEENAFFEWAEVFGNYYGTSRRVIEQTLNEGIDVFLDID
FT                   WQGAQQVKKLMPESIGVFILPPSRAELERRLAGRGQDSNEIIAGRMAQAASEISHYAEY
FT                   DFIIINDDFDTALADLIAIIRSQRLTGAGQIHAQNDMIKDLLAD"
     MTARGNLFIV SAPSGAGKSS LISALLKDKP TDKQVSVSHT TRQPRPGEVN GQHYHFVTVE        60
     EFKALIEENA FFEWAEVFGN YYGTSRRVIE QTLNEGIDVF LDIDWQGAQQ VKKLMPESIG       120
     VFILPPSRAE LERRLAGRGQ DSNEIIAGRM AQAASEISHY AEYDFIIIND DFDTALADLI       180
     AIIRSQRLTG AGQIHAQNDM IKDLLAD                                           207
//

If you have problems or comments...

PBIL Back to PBIL home page