(data stored in ACNUC7421 zone)

EMBL: CP000821.PE337

CP000821.PE337       Location/Qualifiers
FT   CDS             390490..391557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0337"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_3496 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34950"
FT                   /db_xref="GOA:A8FQ27"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ27"
FT                   /protein_id="ABV34950.1"
FT                   /translation="MQYRSLFCVRGRDNGPRFALISALAYLILLLGFIFIGASSALIII
FT                   GLFLTPLLGLSGLRRMRDAARPAWLLGLSFIPLLFFVLSLVYGDSLSFSASCVVFATLI
FT                   TGFLAMQRSASKNSHYHQGYSGPAAMTAGGKGRKRVEPTLDGSAAPVGGHISDNMSEQV
FT                   EEPESYEETGRGFDGISLEQWSSWAKQNRRLLLASVGGLSCMILIAGVWSLFSGAAGDE
FT                   DVAQEPEVSAPQIIVKRDEVKLPDGFSLILEHDLLVMRWLGETEEPGTIWSLATAQGDK
FT                   TCAHLIFNNGTRYRPVTVEQMPDTGIEARFSPLDTESIISDIARRGSVKLCGYDFSLKG
FT                   SQSALAKSGSFIPYL"
     MQYRSLFCVR GRDNGPRFAL ISALAYLILL LGFIFIGASS ALIIIGLFLT PLLGLSGLRR        60
     MRDAARPAWL LGLSFIPLLF FVLSLVYGDS LSFSASCVVF ATLITGFLAM QRSASKNSHY       120
     HQGYSGPAAM TAGGKGRKRV EPTLDGSAAP VGGHISDNMS EQVEEPESYE ETGRGFDGIS       180
     LEQWSSWAKQ NRRLLLASVG GLSCMILIAG VWSLFSGAAG DEDVAQEPEV SAPQIIVKRD       240
     EVKLPDGFSL ILEHDLLVMR WLGETEEPGT IWSLATAQGD KTCAHLIFNN GTRYRPVTVE       300
     QMPDTGIEAR FSPLDTESII SDIARRGSVK LCGYDFSLKG SQSALAKSGS FIPYL            355
//

If you have problems or comments...

PBIL Back to PBIL home page