(data stored in ACNUC7421 zone)

EMBL: CP000821.PE338

CP000821.PE338       Location/Qualifiers
FT   CDS             391663..392631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0338"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shm:Shewmr7_0332 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34951"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ28"
FT                   /protein_id="ABV34951.1"
FT                   /translation="MTLTAIMNENRPLTLVIMAAGLGSRFGGDKQLAALGPNGETMLEL
FT                   STISAYKAGFTQVVLVIRPELEAQLESLFCERVKPQVSSEFQYHFCYQKIDDLPAEALT
FT                   HFDTFDHRLKPWGTAHALWCTRHKVKGLMAVINADDFYGDTAFELLAQGLRNRPQEWML
FT                   VAYPLHLTLSEHGGVNRGVCRVDQGVLQGVAEWTDIRQEPQGLVGLCDGESGNLKSSTP
FT                   VSMTCWGFSAAIFSVLEDALNQFIVEHGHEQRAECYLPTVIQHHMDSAKLNKQPNNEQE
FT                   ARVIRVETAQEPWFGVTYPQDVAWVQNKLNELVNKKNGVVA"
     MTLTAIMNEN RPLTLVIMAA GLGSRFGGDK QLAALGPNGE TMLELSTISA YKAGFTQVVL        60
     VIRPELEAQL ESLFCERVKP QVSSEFQYHF CYQKIDDLPA EALTHFDTFD HRLKPWGTAH       120
     ALWCTRHKVK GLMAVINADD FYGDTAFELL AQGLRNRPQE WMLVAYPLHL TLSEHGGVNR       180
     GVCRVDQGVL QGVAEWTDIR QEPQGLVGLC DGESGNLKSS TPVSMTCWGF SAAIFSVLED       240
     ALNQFIVEHG HEQRAECYLP TVIQHHMDSA KLNKQPNNEQ EARVIRVETA QEPWFGVTYP       300
     QDVAWVQNKL NELVNKKNGV VA                                                322
//

If you have problems or comments...

PBIL Back to PBIL home page