(data stored in ACNUC7421 zone)

EMBL: CP000821.PE340

CP000821.PE340       Location/Qualifiers
FT   CDS             complement(394139..395614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0340"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: vvy:VVA1406 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34953"
FT                   /db_xref="GOA:A8FQ30"
FT                   /db_xref="InterPro:IPR021794"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ30"
FT                   /protein_id="ABV34953.1"
FT                   /translation="MSENRQEGSVNSELSYQQAHKPASDFETREAYLNNELIIMRFRRW
FT                   RLHLPFRDFGIEPEDLVPALAATIGKVVMVTAMAAAFAVQFGLTPEFVAENVRYELLIA
FT                   GVLFVILFSALLNPNTNLAGTHGPMIPLIPLIAAAGGHPLALGIMVGLFGLLLSFSKGG
FT                   SKLVKLTGEGVRGGLLIYLGAVGLIGQITKLELWSGSIGQGAVSFGVILATIVIYAYLA
FT                   KIHKRWLAIPLCSLIAGLVAFAMGTPFEFVTEPGLPHFSPSYWWGESTGWQLGWPSISH
FT                   YVAVIPFAILAVAMWSPDFLGHRVFQELNYPKKAEGVLMNVDDTMTVCSIRQIVGSILG
FT                   GGNLASSWGTYMIPAAIAKRPIPGGAVLTGIMCVLAAVIGYPMDLAMWEPVLRVALLVG
FT                   VFLPLLEAGMQMVRDTQDSQAAGICLFSCAFVNPVFGWALTMLLDNMGFIGDKTRSEKL
FT                   SLMDKLIIPLTAFIICVGSLALVGQLPGIPALL"
     MSENRQEGSV NSELSYQQAH KPASDFETRE AYLNNELIIM RFRRWRLHLP FRDFGIEPED        60
     LVPALAATIG KVVMVTAMAA AFAVQFGLTP EFVAENVRYE LLIAGVLFVI LFSALLNPNT       120
     NLAGTHGPMI PLIPLIAAAG GHPLALGIMV GLFGLLLSFS KGGSKLVKLT GEGVRGGLLI       180
     YLGAVGLIGQ ITKLELWSGS IGQGAVSFGV ILATIVIYAY LAKIHKRWLA IPLCSLIAGL       240
     VAFAMGTPFE FVTEPGLPHF SPSYWWGEST GWQLGWPSIS HYVAVIPFAI LAVAMWSPDF       300
     LGHRVFQELN YPKKAEGVLM NVDDTMTVCS IRQIVGSILG GGNLASSWGT YMIPAAIAKR       360
     PIPGGAVLTG IMCVLAAVIG YPMDLAMWEP VLRVALLVGV FLPLLEAGMQ MVRDTQDSQA       420
     AGICLFSCAF VNPVFGWALT MLLDNMGFIG DKTRSEKLSL MDKLIIPLTA FIICVGSLAL       480
     VGQLPGIPAL L                                                            491
//

If you have problems or comments...

PBIL Back to PBIL home page