(data stored in ACNUC7421 zone)

EMBL: CP000821.PE344

CP000821.PE344       Location/Qualifiers
FT   CDS             complement(398611..400170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0344"
FT                   /product="flavocytochrome c flavin subunit, putative"
FT                   /note="KEGG: son:SO3058 flavocytochrome c flavin subunit,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34957"
FT                   /db_xref="GOA:A8FQ34"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR010960"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ34"
FT                   /protein_id="ABV34957.1"
FT                   /translation="MSDKQPISLRRRQLITGGAALAVTGLGASLAKPVSAACVPAEEVK
FT                   FDEVVDIIVVGSGFAGMSAALQAREAGASVMVVDKMPVFGGNSTINGGAMAVAGSPLQQ
FT                   QNGIKDSVDTMVADMLEAGRGMNDVEMLKLVCNGTAESCQWLTDYGVKWKPFVQHFGGH
FT                   SIPRVLQTVESSGAGIIRPLVKAAKKRGIDMRTQTKLESFIEDDQGRVTGIEVKANYFF
FT                   PKERSGVTRRYGARKGIIMATGGFGRDIEYRKMQQPKLTKELDSTNHPGANADALKQMM
FT                   LIGANPIHLDQIQLGPWASPDEKGFGTASQFNTIATYPRGIVVDARTGKRFFNELADRK
FT                   ARADAIMTRRDAQGQPVYPIGFTNAEGASKAQTLDWGLKYNVIKKADTLEELAKIYGIP
FT                   ADALKAQVESWNKAVDTGEDSEFGRPMQKAMKLEQGPWYAVRMWPKVHYCMGGVKVNTR
FT                   SEVLHLVTYKPIAGLFAAGEATGGIHGASRLGACAVAEGVVTGRNAGQMCAASKSIVLK
FT                   HV"
     MSDKQPISLR RRQLITGGAA LAVTGLGASL AKPVSAACVP AEEVKFDEVV DIIVVGSGFA        60
     GMSAALQARE AGASVMVVDK MPVFGGNSTI NGGAMAVAGS PLQQQNGIKD SVDTMVADML       120
     EAGRGMNDVE MLKLVCNGTA ESCQWLTDYG VKWKPFVQHF GGHSIPRVLQ TVESSGAGII       180
     RPLVKAAKKR GIDMRTQTKL ESFIEDDQGR VTGIEVKANY FFPKERSGVT RRYGARKGII       240
     MATGGFGRDI EYRKMQQPKL TKELDSTNHP GANADALKQM MLIGANPIHL DQIQLGPWAS       300
     PDEKGFGTAS QFNTIATYPR GIVVDARTGK RFFNELADRK ARADAIMTRR DAQGQPVYPI       360
     GFTNAEGASK AQTLDWGLKY NVIKKADTLE ELAKIYGIPA DALKAQVESW NKAVDTGEDS       420
     EFGRPMQKAM KLEQGPWYAV RMWPKVHYCM GGVKVNTRSE VLHLVTYKPI AGLFAAGEAT       480
     GGIHGASRLG ACAVAEGVVT GRNAGQMCAA SKSIVLKHV                              519
//

If you have problems or comments...

PBIL Back to PBIL home page