(data stored in ACNUC7421 zone)

EMBL: CP000821.PE345

CP000821.PE345       Location/Qualifiers
FT   CDS             complement(400647..401804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0345"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_0274 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34958"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ35"
FT                   /protein_id="ABV34958.1"
FT                   /translation="MMKKSTQLMLSAVATAVAMAGSIGCAQAQEDGINIGGSVRVNYGL
FT                   KLYDDSSKDKGGDLVFDTATLVMKGKKGDFGLAAEYRFTKSTNFIKYGYGYYDIDPDWQ
FT                   LQFGINKVPFGNPGFISNSWWFGLPYYLGFEDDHDIGIKAVYEKNGWHTDLAFYKGAEY
FT                   GPSEIKRYATDLFTGTIDTTYDGIDNGTEYNNEETNQLNLRQTYTMEHEGGSTTFGASV
FT                   EAGQIYNNKTGNNGDRYAVAAHMETLYNGWKLQLQAMQYEYDAADAADDNKIGVSVVNW
FT                   QYEIASKGQVYSLNLAKTMPTSWGSVKCYNDFGLMTPDVADSSYDDSIQNVTGCAVSAG
FT                   PTYTMIDFIMGKNMTFSTKNNDHVGLPEFGDDLDKRININFGYYF"
     MMKKSTQLML SAVATAVAMA GSIGCAQAQE DGINIGGSVR VNYGLKLYDD SSKDKGGDLV        60
     FDTATLVMKG KKGDFGLAAE YRFTKSTNFI KYGYGYYDID PDWQLQFGIN KVPFGNPGFI       120
     SNSWWFGLPY YLGFEDDHDI GIKAVYEKNG WHTDLAFYKG AEYGPSEIKR YATDLFTGTI       180
     DTTYDGIDNG TEYNNEETNQ LNLRQTYTME HEGGSTTFGA SVEAGQIYNN KTGNNGDRYA       240
     VAAHMETLYN GWKLQLQAMQ YEYDAADAAD DNKIGVSVVN WQYEIASKGQ VYSLNLAKTM       300
     PTSWGSVKCY NDFGLMTPDV ADSSYDDSIQ NVTGCAVSAG PTYTMIDFIM GKNMTFSTKN       360
     NDHVGLPEFG DDLDKRININ FGYYF                                             385
//

If you have problems or comments...

PBIL Back to PBIL home page