(data stored in ACNUC7421 zone)

EMBL: CP000821.PE347

CP000821.PE347       Location/Qualifiers
FT   CDS             complement(403972..404430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0347"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sfr:Sfri_3125 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34960"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ37"
FT                   /protein_id="ABV34960.1"
FT                   /translation="MTFIKALGAQWNKGKLAQQLEQALLQEPEIHSLFIGATTVTTVSN
FT                   LIAAIGFREPETQEQELPLTHEFMLTILFDCFRLLMIKQIEHDNLSQAEHLIIQIAKIW
FT                   ATKEMEEKPDNEICLTQYRELQQQILNLTEQLDELNRQRRLQKRNMGR"
     MTFIKALGAQ WNKGKLAQQL EQALLQEPEI HSLFIGATTV TTVSNLIAAI GFREPETQEQ        60
     ELPLTHEFML TILFDCFRLL MIKQIEHDNL SQAEHLIIQI AKIWATKEME EKPDNEICLT       120
     QYRELQQQIL NLTEQLDELN RQRRLQKRNM GR                                     152
//

If you have problems or comments...

PBIL Back to PBIL home page