(data stored in ACNUC7421 zone)

EMBL: CP000821.PE349

CP000821.PE349       Location/Qualifiers
FT   CDS             complement(405205..405840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0349"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein"
FT                   /note="KEGG: sfr:Sfri_3127 4Fe-4S ferredoxin, iron-sulfur
FT                   binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34962"
FT                   /db_xref="InterPro:IPR014297"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ39"
FT                   /protein_id="ABV34962.1"
FT                   /translation="MSNNIQYGFHVDASKCTGCKTCQVSCKDRKDLPVGINWRRVYEYG
FT                   GGQWTENGDGTVSQNVFAYYMSIGCNHCSEPVCVKACPTGAMHKRREDGLVHVAADLCI
FT                   GCESCARACPYDAPQIDKDRKVMTKCDGCYERLAEGKQPSCVESCPMRAIDFGPMDELK
FT                   AKYPGAISPDVAPLPESSVTTPNLLITPNRHTRPSGATDGEVLNYSEV"
     MSNNIQYGFH VDASKCTGCK TCQVSCKDRK DLPVGINWRR VYEYGGGQWT ENGDGTVSQN        60
     VFAYYMSIGC NHCSEPVCVK ACPTGAMHKR REDGLVHVAA DLCIGCESCA RACPYDAPQI       120
     DKDRKVMTKC DGCYERLAEG KQPSCVESCP MRAIDFGPMD ELKAKYPGAI SPDVAPLPES       180
     SVTTPNLLIT PNRHTRPSGA TDGEVLNYSE V                                      211
//

If you have problems or comments...

PBIL Back to PBIL home page