(data stored in ACNUC7421 zone)

EMBL: CP000821.PE35

CP000821.PE35        Location/Qualifiers
FT   CDS             complement(41785..42297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0035"
FT                   /product="Peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /note="KEGG: slo:Shew_3736 peptide deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34648"
FT                   /db_xref="GOA:A8FP75"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:A8FP75"
FT                   /protein_id="ABV34648.1"
FT                   /translation="MSLLKVLRFPDERLRTIAKPVAEFNADLQAQIDNMFDTMYEEKGI
FT                   GLAATQVDFHQHLIIMDLQDDVERPTVFINMEITARDGSCTNEEGCLSVPGIYANVDRA
FT                   ESVTIKAFDREGVEFTLDADGLFAICLQHELDHLNGKLFVDYLSPLKRQRIKQKLEKAA
FT                   RLEAKQG"
     MSLLKVLRFP DERLRTIAKP VAEFNADLQA QIDNMFDTMY EEKGIGLAAT QVDFHQHLII        60
     MDLQDDVERP TVFINMEITA RDGSCTNEEG CLSVPGIYAN VDRAESVTIK AFDREGVEFT       120
     LDADGLFAIC LQHELDHLNG KLFVDYLSPL KRQRIKQKLE KAARLEAKQG                  170
//

If you have problems or comments...

PBIL Back to PBIL home page