(data stored in ACNUC7421 zone)

EMBL: CP000821.PE350

CP000821.PE350       Location/Qualifiers
FT   CDS             complement(405853..408282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0350"
FT                   /product="anaerobic dimethyl sulfoxide reductase, A
FT                   subunit, DmsA/YnfE family protein"
FT                   /note="KEGG: sfr:Sfri_3128 anaerobic dimethyl sulfoxide
FT                   reductase, A subunit, DmsA/YnfE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34963"
FT                   /db_xref="GOA:A8FQ40"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR011888"
FT                   /db_xref="InterPro:IPR027467"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ40"
FT                   /protein_id="ABV34963.1"
FT                   /translation="MERRSFLKMSAALSCAATVSGCNSSSKDVEVVPPTPPVAGENLNW
FT                   SACLVNCGSNCPVQVFSTDGVITRVESEFTTTDKYGDHDVRACLRGRSLRKRVYAPDRL
FT                   KYPMKRVGPRGSGQFERISWDEALDLVAEKLQGTIDQYGNESIHFTYNSGARYHFSGKQ
FT                   CLYRLMNLKGGYLNAYGDYSWSQIYEAAGQTYGSAGPGWQGSSVSEMQNSDLVLMVGYN
FT                   PSEIRMSGSGEAYDFLMQKQKNKFKTILIDPRYTDSAVGKEDQWLAIRPGTDAALFEAL
FT                   AYEWITTNTVDQAFLDKYCVGYDEKTMPAGVGYEESYKAYILDNTTVGSSIPGVNAKTP
FT                   EWAAAITGIEAHIIVELARELAAARAPFIQIAASLNRQAAGENNTRAGYMLPILLGQLG
FT                   LPGTNCGGLCKGSFLHAPFMPTGSNPVKKAISFFTFTQAIEDGKNMTVLSDGVQGVDTD
FT                   EEGDGKLGTDIKAIINYGGNALINQHSDVRKTEKLLQDESKCEFILVVDNWMTPSAKFA
FT                   DVLLPDVTWLESEDLIYQSYAAGDTATLVQMSSGVDPMFESRPIYEVCVDLAKRMGVEA
FT                   EFTEGKSRKDWLDQFYAESKAATPGLPDKEVMLTQGIYRKYLPDGGYIVLEDFRNDPEA
FT                   NPLGTPSGKIEIYSSRLADKARTWKLKEGDVISALPKYVPTWEGYEDTETKKKYPLQLT
FT                   GYHTKGRAHSSYHNVPWLREVVQDAVWMNPLDANKRGLKTGDKVHIFNDRGTIEVEVKV
FT                   TPRIMVGVTALGQGAWFQPGGDVDKGGCLNVLTTQRTTPVTKGNPQHTNLVEIRKV"
     MERRSFLKMS AALSCAATVS GCNSSSKDVE VVPPTPPVAG ENLNWSACLV NCGSNCPVQV        60
     FSTDGVITRV ESEFTTTDKY GDHDVRACLR GRSLRKRVYA PDRLKYPMKR VGPRGSGQFE       120
     RISWDEALDL VAEKLQGTID QYGNESIHFT YNSGARYHFS GKQCLYRLMN LKGGYLNAYG       180
     DYSWSQIYEA AGQTYGSAGP GWQGSSVSEM QNSDLVLMVG YNPSEIRMSG SGEAYDFLMQ       240
     KQKNKFKTIL IDPRYTDSAV GKEDQWLAIR PGTDAALFEA LAYEWITTNT VDQAFLDKYC       300
     VGYDEKTMPA GVGYEESYKA YILDNTTVGS SIPGVNAKTP EWAAAITGIE AHIIVELARE       360
     LAAARAPFIQ IAASLNRQAA GENNTRAGYM LPILLGQLGL PGTNCGGLCK GSFLHAPFMP       420
     TGSNPVKKAI SFFTFTQAIE DGKNMTVLSD GVQGVDTDEE GDGKLGTDIK AIINYGGNAL       480
     INQHSDVRKT EKLLQDESKC EFILVVDNWM TPSAKFADVL LPDVTWLESE DLIYQSYAAG       540
     DTATLVQMSS GVDPMFESRP IYEVCVDLAK RMGVEAEFTE GKSRKDWLDQ FYAESKAATP       600
     GLPDKEVMLT QGIYRKYLPD GGYIVLEDFR NDPEANPLGT PSGKIEIYSS RLADKARTWK       660
     LKEGDVISAL PKYVPTWEGY EDTETKKKYP LQLTGYHTKG RAHSSYHNVP WLREVVQDAV       720
     WMNPLDANKR GLKTGDKVHI FNDRGTIEVE VKVTPRIMVG VTALGQGAWF QPGGDVDKGG       780
     CLNVLTTQRT TPVTKGNPQH TNLVEIRKV                                         809
//

If you have problems or comments...

PBIL Back to PBIL home page