(data stored in ACNUC7421 zone)

EMBL: CP000821.PE351

CP000821.PE351       Location/Qualifiers
FT   CDS             complement(408323..410329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0351"
FT                   /product="outer membrane protein"
FT                   /note="KEGG: sfr:Sfri_3129 outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34964"
FT                   /db_xref="InterPro:IPR020016"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ41"
FT                   /protein_id="ABV34964.1"
FT                   /translation="MRFKFNLITLSLLAISGAVTGSAMAADFGVNRANTSTVKQETFQC
FT                   KRCPQVDGYTGTVGINAAYIESDDIHSGNAFGTDKDGANASLDADLNYRNGAGYKARFQ
FT                   AHQLGLDNGFAHLEAGKSGRYEITADYQQLTSYQSGDARSQLWYKDGVLTPSEHTQTQE
FT                   LSLQRNKAGLGLSYGRDFYQAYIRYDHENKTGYQSSSIVTPRPVNFGLPVDANTDNLTA
FT                   GLSLSGDNWATDLNYFVSQYKNDIGALSLPYLYDVFAPTPDNEAHQISLSGQYQLSRTV
FT                   MSGRLASGKMIQDDDLIQMSGNPIQNWDGEVETLDGKLSVTSLLSNKLRLGGSVDYSKR
FT                   DNKGSVWEFAQYEVNGITGAFKQNVPLDTERRGLKVNASYRFSSDYRLQAGYDRKEMER
FT                   SHGDREQTNDDVLWAKLNVRALDDIKLKFKASLDNRGGSEYQTSELTSSETNPLLRKYY
FT                   LADRKRTAFEAKFNHTPTSWLSLDMTARYAKDDYDKTQLGLTGSEDYGYDINLGLQLDV
FT                   HLSGYAFAGQQWIDSNQTGSQSFSAPDWSADIEDEFINLGAGFTYTGLLEDKLTLGGDY
FT                   LFANSTSDTLVIYDVVTPQGDYYSFNHSLKLHANYALSEEMALKLAYQYERYYDTDYAQ
FT                   IDVDTVPGLTTLGDLNHNYNAHQVMLSFSYQLR"
     MRFKFNLITL SLLAISGAVT GSAMAADFGV NRANTSTVKQ ETFQCKRCPQ VDGYTGTVGI        60
     NAAYIESDDI HSGNAFGTDK DGANASLDAD LNYRNGAGYK ARFQAHQLGL DNGFAHLEAG       120
     KSGRYEITAD YQQLTSYQSG DARSQLWYKD GVLTPSEHTQ TQELSLQRNK AGLGLSYGRD       180
     FYQAYIRYDH ENKTGYQSSS IVTPRPVNFG LPVDANTDNL TAGLSLSGDN WATDLNYFVS       240
     QYKNDIGALS LPYLYDVFAP TPDNEAHQIS LSGQYQLSRT VMSGRLASGK MIQDDDLIQM       300
     SGNPIQNWDG EVETLDGKLS VTSLLSNKLR LGGSVDYSKR DNKGSVWEFA QYEVNGITGA       360
     FKQNVPLDTE RRGLKVNASY RFSSDYRLQA GYDRKEMERS HGDREQTNDD VLWAKLNVRA       420
     LDDIKLKFKA SLDNRGGSEY QTSELTSSET NPLLRKYYLA DRKRTAFEAK FNHTPTSWLS       480
     LDMTARYAKD DYDKTQLGLT GSEDYGYDIN LGLQLDVHLS GYAFAGQQWI DSNQTGSQSF       540
     SAPDWSADIE DEFINLGAGF TYTGLLEDKL TLGGDYLFAN STSDTLVIYD VVTPQGDYYS       600
     FNHSLKLHAN YALSEEMALK LAYQYERYYD TDYAQIDVDT VPGLTTLGDL NHNYNAHQVM       660
     LSFSYQLR                                                                668
//

If you have problems or comments...

PBIL Back to PBIL home page