(data stored in ACNUC7421 zone)

EMBL: CP000821.PE352

CP000821.PE352       Location/Qualifiers
FT   CDS             complement(410345..411298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0352"
FT                   /product="cytochrome c family protein"
FT                   /note="KEGG: sfr:Sfri_3130 cytochrome c family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34965"
FT                   /db_xref="InterPro:IPR010177"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR020015"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ42"
FT                   /protein_id="ABV34965.1"
FT                   /translation="MMNKCIITKLLCGIFAFACLSLSVQAAPWNQLTGEQLEQKLAEKF
FT                   AQGKYSKKGADSCLMCHKKNDKVMAIFGGVHGNTSQPDSPMAGLQCEACHGPLGKHNKG
FT                   GKEPMIAFGKESKLPAQSQNSVCLGCHNDPKQMAWHSSSHNLDEVACSDCHNIHTDKDP
FT                   VMDQLTVNDTCTSCHTQQKSDMNKRSSHPMKWDQMTCIDCHNPHGSMSESALNHTTVND
FT                   TCYSCHGEKRGPVLWEHAPVTENCANCHNPHGSVNEAMLTHRAPQLCQQCHMDDGHASR
FT                   VVQQGGSDAFGGGKSCLNCHSQIHGSNHPAGSKLQR"
     MMNKCIITKL LCGIFAFACL SLSVQAAPWN QLTGEQLEQK LAEKFAQGKY SKKGADSCLM        60
     CHKKNDKVMA IFGGVHGNTS QPDSPMAGLQ CEACHGPLGK HNKGGKEPMI AFGKESKLPA       120
     QSQNSVCLGC HNDPKQMAWH SSSHNLDEVA CSDCHNIHTD KDPVMDQLTV NDTCTSCHTQ       180
     QKSDMNKRSS HPMKWDQMTC IDCHNPHGSM SESALNHTTV NDTCYSCHGE KRGPVLWEHA       240
     PVTENCANCH NPHGSVNEAM LTHRAPQLCQ QCHMDDGHAS RVVQQGGSDA FGGGKSCLNC       300
     HSQIHGSNHP AGSKLQR                                                      317
//

If you have problems or comments...

PBIL Back to PBIL home page