(data stored in ACNUC7421 zone)

EMBL: CP000821.PE354

CP000821.PE354       Location/Qualifiers
FT   CDS             414104..414796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0354"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: slo:Shew_0277 transcriptional regulator, TetR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34967"
FT                   /db_xref="GOA:A8FQ44"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ44"
FT                   /protein_id="ABV34967.1"
FT                   /translation="MSKLERESRLLEVARELILEHGMMSFKFTDIAKRAEVSRATLYKY
FT                   FSGKEDVLVSLFVSDAGNTLQMLLDIQADEILNDREKILLSLLAPVASSMEALNRSGTL
FT                   LLSANPGIFMFAGEAHQAKLEQIVAQIRGIVLEFWVIPFKQGHMRVTQEQLEEVMASTF
FT                   PYQRGCVTIPQNVMTVGKQINYPLKKVFENLLKLTEALDWCEEHANVDYEKTLIGIGRH
FT                   KRNEMIAY"
     MSKLERESRL LEVARELILE HGMMSFKFTD IAKRAEVSRA TLYKYFSGKE DVLVSLFVSD        60
     AGNTLQMLLD IQADEILNDR EKILLSLLAP VASSMEALNR SGTLLLSANP GIFMFAGEAH       120
     QAKLEQIVAQ IRGIVLEFWV IPFKQGHMRV TQEQLEEVMA STFPYQRGCV TIPQNVMTVG       180
     KQINYPLKKV FENLLKLTEA LDWCEEHANV DYEKTLIGIG RHKRNEMIAY                  230
//

If you have problems or comments...

PBIL Back to PBIL home page