(data stored in ACNUC7421 zone)

EMBL: CP000821.PE355

CP000821.PE355       Location/Qualifiers
FT   CDS             complement(414994..415314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0355"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34968"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ45"
FT                   /protein_id="ABV34968.1"
FT                   /translation="MAGWIEDYISKSLDIHPRVFGQVTIGAVSNYISSSAREYIEEAYS
FT                   ADVEIESFIHVCMCSAVCTMGSKRGDVQNIVVYVIKKAAVKCPLLHPLIESVPQSKLTS
FT                   IV"
     MAGWIEDYIS KSLDIHPRVF GQVTIGAVSN YISSSAREYI EEAYSADVEI ESFIHVCMCS        60
     AVCTMGSKRG DVQNIVVYVI KKAAVKCPLL HPLIESVPQS KLTSIV                      106
//

If you have problems or comments...

PBIL Back to PBIL home page