(data stored in ACNUC7421 zone)

EMBL: CP000821.PE356

CP000821.PE356       Location/Qualifiers
FT   CDS             complement(415350..415970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0356"
FT                   /product="cytoplasmic chaperone TorD family protein"
FT                   /note="KEGG: sfr:Sfri_3126 cytoplasmic chaperone TorD
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34969"
FT                   /db_xref="InterPro:IPR020945"
FT                   /db_xref="InterPro:IPR036411"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ46"
FT                   /protein_id="ABV34969.1"
FT                   /translation="MNKALAEITPILAANMYHDPCDKVLEMYNEHDFSECYPLLTQSNT
FT                   RSEGVALISNYMKQYTSEQLPKLLLDFNQLFIGPGKMKVPLWGSYYLSEDNLLCGPSTQ
FT                   KLQARIDALGIAINTIDGDNQPIDHISLVLRLVEFALDEERSLELKAIVTEHLVPWAYR
FT                   VAELTIEHAKTNFYLGWGLLLKDYLDVLVESNGIIVKEHTLWG"
     MNKALAEITP ILAANMYHDP CDKVLEMYNE HDFSECYPLL TQSNTRSEGV ALISNYMKQY        60
     TSEQLPKLLL DFNQLFIGPG KMKVPLWGSY YLSEDNLLCG PSTQKLQARI DALGIAINTI       120
     DGDNQPIDHI SLVLRLVEFA LDEERSLELK AIVTEHLVPW AYRVAELTIE HAKTNFYLGW       180
     GLLLKDYLDV LVESNGIIVK EHTLWG                                            206
//

If you have problems or comments...

PBIL Back to PBIL home page