(data stored in ACNUC7421 zone)

EMBL: CP000821.PE357

CP000821.PE357       Location/Qualifiers
FT   CDS             complement(416026..418128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0357"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO4356 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34970"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ47"
FT                   /protein_id="ABV34970.1"
FT                   /translation="MNTKLSLVAVLLAGAMVTGCSDDDSETVYVCENGDTVSAPEQCPT
FT                   TPTDPTDPVEPPAVDGPFVHAGRTIIDGAFYSATSPSNEYDPLRDWENTMPAGYKEMRN
FT                   ASYPWGTTVYNSAANGEELWMGTISNGWCVWPYQNIAMPIELTTFESETTGCSVPGTTG
FT                   TPSQIFIYNFRTGAKEVIHESMLTSGGPQFTEAFKPINNTYGFRAAGTAGDLVFVAGHW
FT                   KTTEDKGRLRLFVFNAKERSFVGYRDIVGDTTRRFRTLEHADGTTGFYTIVGAETGMTQ
FT                   YGDGPTQLLRWVGTQDDPFAGGNIKGTDPLTTTGWSKVSTQLDNEQTPDGVQYGMIGDW
FT                   RQFTHTDGTERLIMSASAHPFVYKNGVRSDKFKESVILISDPIPNSGYTVDEQLTFREV
FT                   FGMDQYDPDTKGRWGAKWGTSAINDGYMYFGTYHQGTDAAYKHFAKADPALFTELTGLE
FT                   SAGEADATKVTDVTTTNDAQATDHKLFMINEWRATSIFRIDLKNIDAVSAGDTSKVELL
FT                   YGYETMEVNDGNGWKTTPNLLGKKPTHGEAGMGNPGNVYSWTSIAKDGKLFWGFFDAFS
FT                   GLHDLLFEAYSGEYMLFDGIVFQNPVWKRQMANNPAMWMYDYAKAEMDANGLGAEFIPG
FT                   GDLLMIEADGSARKLTTNGFGNQCSNGIRNVVDIDDKLYFGTSTWCNVGPTSGLEFYQY
FT                   EPSLDK"
     MNTKLSLVAV LLAGAMVTGC SDDDSETVYV CENGDTVSAP EQCPTTPTDP TDPVEPPAVD        60
     GPFVHAGRTI IDGAFYSATS PSNEYDPLRD WENTMPAGYK EMRNASYPWG TTVYNSAANG       120
     EELWMGTISN GWCVWPYQNI AMPIELTTFE SETTGCSVPG TTGTPSQIFI YNFRTGAKEV       180
     IHESMLTSGG PQFTEAFKPI NNTYGFRAAG TAGDLVFVAG HWKTTEDKGR LRLFVFNAKE       240
     RSFVGYRDIV GDTTRRFRTL EHADGTTGFY TIVGAETGMT QYGDGPTQLL RWVGTQDDPF       300
     AGGNIKGTDP LTTTGWSKVS TQLDNEQTPD GVQYGMIGDW RQFTHTDGTE RLIMSASAHP       360
     FVYKNGVRSD KFKESVILIS DPIPNSGYTV DEQLTFREVF GMDQYDPDTK GRWGAKWGTS       420
     AINDGYMYFG TYHQGTDAAY KHFAKADPAL FTELTGLESA GEADATKVTD VTTTNDAQAT       480
     DHKLFMINEW RATSIFRIDL KNIDAVSAGD TSKVELLYGY ETMEVNDGNG WKTTPNLLGK       540
     KPTHGEAGMG NPGNVYSWTS IAKDGKLFWG FFDAFSGLHD LLFEAYSGEY MLFDGIVFQN       600
     PVWKRQMANN PAMWMYDYAK AEMDANGLGA EFIPGGDLLM IEADGSARKL TTNGFGNQCS       660
     NGIRNVVDID DKLYFGTSTW CNVGPTSGLE FYQYEPSLDK                             700
//

If you have problems or comments...

PBIL Back to PBIL home page