(data stored in ACNUC7421 zone)

EMBL: CP000821.PE358

CP000821.PE358       Location/Qualifiers
FT   CDS             complement(418130..418747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0358"
FT                   /product="anaerobic dimethyl sulfoxide reductase, subunit
FT                   B"
FT                   /note="KEGG: vpa:VP1448 anaerobic dimethyl sulfoxide
FT                   reductase, subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34971"
FT                   /db_xref="InterPro:IPR014297"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ48"
FT                   /protein_id="ABV34971.1"
FT                   /translation="MQLGFYVDTSICSGCKACMVSCKDKNDLNVGRNFRRVYEYAGGSC
FT                   TDNGNGVFSQSVFAYYTSISCNHCDTPACTKACPTGAMHKRSEDGLVMIHDDICIGCSS
FT                   CEQACPYDAPQLDEARGKMTKCDACIDRLNAGKQPMCVDSCIHRALDFGPIDELRAKYG
FT                   DTAEIAPLPSASITKPNLILRVHPDGQPVGSGAGSVVNPNEV"
     MQLGFYVDTS ICSGCKACMV SCKDKNDLNV GRNFRRVYEY AGGSCTDNGN GVFSQSVFAY        60
     YTSISCNHCD TPACTKACPT GAMHKRSEDG LVMIHDDICI GCSSCEQACP YDAPQLDEAR       120
     GKMTKCDACI DRLNAGKQPM CVDSCIHRAL DFGPIDELRA KYGDTAEIAP LPSASITKPN       180
     LILRVHPDGQ PVGSGAGSVV NPNEV                                             205
//

If you have problems or comments...

PBIL Back to PBIL home page