(data stored in ACNUC7421 zone)

EMBL: CP000821.PE359

CP000821.PE359       Location/Qualifiers
FT   CDS             complement(418758..421208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0359"
FT                   /product="anaerobic dimethyl sulfoxide reductase, A
FT                   subunit, DmsA/YnfE family protein"
FT                   /note="KEGG: sfr:Sfri_3128 anaerobic dimethyl sulfoxide
FT                   reductase, A subunit, DmsA/YnfE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34972"
FT                   /db_xref="GOA:A8FQ49"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR011888"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ49"
FT                   /protein_id="ABV34972.1"
FT                   /translation="MERRTFLKFSAAAAAVATVTGCESSSASNPLPAPSEPVLPPVGEG
FT                   ITWGSCATNCWQACPLKVHSKDGVITRIETEGKATDDWDNFDHEIRPCPRGRSMRQKVY
FT                   NHDRLKYPMKRVGRRGSDEFVRISWEEAVSSVASAMEQTYSQYGKNAIFMPLGGGSHDL
FT                   NTGVTQSSVRLLNMAGGCLFFHNDYSAAQYREGSAGMYGYLASNAGDTVGFWNTGSSLR
FT                   SLEDSDLMVCFGYNPMEARLGGAGSGYEYLNVKKKNNFKTYYIDPRFTDTAVTANDEWI
FT                   PIRPGTDAALCEAIAYVLIEDGYADIPFLEQYTHGYDKYQDYITGVTDGTTKTPERAEG
FT                   ICGIPAEKIREIAQAIGAASAPFVTQGFGPQRQGNGENNARAVMMLPLLVGKISGDGTN
FT                   HGGTPGNDGLSHYAMMPADTLQDLMNMKIMDVTIPAASHLDAIEFGMQMKPSTHDVRYS
FT                   NPDLMAADTPLETNVRFLWLASSNMLANQNGDINRADRLLNDESLVDFVVVVEQHMTAS
FT                   AKYADIILPEVSWLEMYDVIQSYNKMDCGSLMYAYGITPAVDPMFECKPAYDICHMIAN
FT                   QLGIGSKFTNGGMTYLDQVRKVFAEFKKSNPWIQGDTFEEFVSFGPQRRPAGEHPNVGK
FT                   IRDFITDPIASPLGTPSGKVEIYSQYFEGKQTQAEGTDEINPLPVYFACDESYEDATAS
FT                   EFPLQCINYHGKHSAHSIHASTPWLNEVLEHHLWLNPIDAGAAGVINGQKVIVESRRGK
FT                   LEITARVTPRIVPGVVAMPQGQWRRMKGDIDVGGCANTLTDSKPSPVAKSFRSNTNRVR
FT                   VYSA"
     MERRTFLKFS AAAAAVATVT GCESSSASNP LPAPSEPVLP PVGEGITWGS CATNCWQACP        60
     LKVHSKDGVI TRIETEGKAT DDWDNFDHEI RPCPRGRSMR QKVYNHDRLK YPMKRVGRRG       120
     SDEFVRISWE EAVSSVASAM EQTYSQYGKN AIFMPLGGGS HDLNTGVTQS SVRLLNMAGG       180
     CLFFHNDYSA AQYREGSAGM YGYLASNAGD TVGFWNTGSS LRSLEDSDLM VCFGYNPMEA       240
     RLGGAGSGYE YLNVKKKNNF KTYYIDPRFT DTAVTANDEW IPIRPGTDAA LCEAIAYVLI       300
     EDGYADIPFL EQYTHGYDKY QDYITGVTDG TTKTPERAEG ICGIPAEKIR EIAQAIGAAS       360
     APFVTQGFGP QRQGNGENNA RAVMMLPLLV GKISGDGTNH GGTPGNDGLS HYAMMPADTL       420
     QDLMNMKIMD VTIPAASHLD AIEFGMQMKP STHDVRYSNP DLMAADTPLE TNVRFLWLAS       480
     SNMLANQNGD INRADRLLND ESLVDFVVVV EQHMTASAKY ADIILPEVSW LEMYDVIQSY       540
     NKMDCGSLMY AYGITPAVDP MFECKPAYDI CHMIANQLGI GSKFTNGGMT YLDQVRKVFA       600
     EFKKSNPWIQ GDTFEEFVSF GPQRRPAGEH PNVGKIRDFI TDPIASPLGT PSGKVEIYSQ       660
     YFEGKQTQAE GTDEINPLPV YFACDESYED ATASEFPLQC INYHGKHSAH SIHASTPWLN       720
     EVLEHHLWLN PIDAGAAGVI NGQKVIVESR RGKLEITARV TPRIVPGVVA MPQGQWRRMK       780
     GDIDVGGCAN TLTDSKPSPV AKSFRSNTNR VRVYSA                                 816
//

If you have problems or comments...

PBIL Back to PBIL home page