(data stored in ACNUC7421 zone)

EMBL: CP000821.PE360

CP000821.PE360       Location/Qualifiers
FT   CDS             complement(421242..422939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0360"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sfr:Sfri_3685 outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34973"
FT                   /db_xref="InterPro:IPR020016"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ50"
FT                   /protein_id="ABV34973.1"
FT                   /translation="MKAKLTLVALAVLSVNATAANFAVPQDIEKDYACKRCVATEHANT
FT                   VGIITEQRSHLDTQYGASADIKGANYSINAVEAGADNGHLKAAAHLGDFALELAYVNRW
FT                   NLDDNDIGAERQQLSVGAKYQTQLVTAFVKASSEDKQGQRIGSVVDPKPTNYLETIDHT
FT                   TQVMNAGLQLHGDFWNLGVAAFNSEFTDNAGIDADNSAQQASVKAGLNYGSTRLSVSAA
FT                   SGKMIQDEAIEQENSLVPISNFDGEVETLDYSARISSRVAGFKVTGFYSYSDRDNVSGS
FT                   YEFFESINTPIDSSKTRLGVDASYRLGSTKFSAGFEQNDRTRTDSDREETQESEVFGRI
FT                   DYRYQQFNSHIKFISGERTGSEYHIGDDIYQKYYLADRDRVSTELGLGYSQNHYGANLK
FT                   VSIASDEYSNSSALKESDEMSVNVDGFYRFNDQMVLNAYAGTQTIDSLEIHNTTVSDEF
FT                   TYFGFGLDQYQINEDIALGTSYTFSLSGSDTAVDSTEMGDYYQYQHLAEIHMDYRISER
FT                   ISTRFAYSYERNYDTNYANQPIDAINTIDDLNQNYTDHKIGAFFTIKL"
     MKAKLTLVAL AVLSVNATAA NFAVPQDIEK DYACKRCVAT EHANTVGIIT EQRSHLDTQY        60
     GASADIKGAN YSINAVEAGA DNGHLKAAAH LGDFALELAY VNRWNLDDND IGAERQQLSV       120
     GAKYQTQLVT AFVKASSEDK QGQRIGSVVD PKPTNYLETI DHTTQVMNAG LQLHGDFWNL       180
     GVAAFNSEFT DNAGIDADNS AQQASVKAGL NYGSTRLSVS AASGKMIQDE AIEQENSLVP       240
     ISNFDGEVET LDYSARISSR VAGFKVTGFY SYSDRDNVSG SYEFFESINT PIDSSKTRLG       300
     VDASYRLGST KFSAGFEQND RTRTDSDREE TQESEVFGRI DYRYQQFNSH IKFISGERTG       360
     SEYHIGDDIY QKYYLADRDR VSTELGLGYS QNHYGANLKV SIASDEYSNS SALKESDEMS       420
     VNVDGFYRFN DQMVLNAYAG TQTIDSLEIH NTTVSDEFTY FGFGLDQYQI NEDIALGTSY       480
     TFSLSGSDTA VDSTEMGDYY QYQHLAEIHM DYRISERIST RFAYSYERNY DTNYANQPID       540
     AINTIDDLNQ NYTDHKIGAF FTIKL                                             565
//

If you have problems or comments...

PBIL Back to PBIL home page