(data stored in ACNUC7421 zone)

EMBL: CP000821.PE362

CP000821.PE362       Location/Qualifiers
FT   CDS             complement(424401..425414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0362"
FT                   /product="integrase, catalytic region"
FT                   /note="KEGG: sfr:Sfri_3878 integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34975"
FT                   /db_xref="GOA:A8FQ52"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ52"
FT                   /protein_id="ABV34975.1"
FT                   /translation="MYSNHNEIRSKLALLQLAKELGSISKACDMMGYSRDSYYRFKKQY
FT                   ENAGEQGLHNLSRKKSTLKNRVSQEVEDQVIEIALDYPNYGQAKVAELLTARGCTISPS
FT                   GVRTIWLRHNLETKQNRLIALNSRLRQQNELDFNAQHQIEKSCKLQQEEGSLDCQGPGD
FT                   ICVQDTFKIGNIPGLGTVYQHTCMDAYSQYTHAHITLEKSSTISSDFLRTQVLPWYKNQ
FT                   YIPINSILTDRGAEFSGKYSQQFQNLLQQTAINHIQKRAYNGPIVNGIAARFHNLAHSE
FT                   FYAPFLKNNKVSNIETLNENLQKWLKRYNHQYAIAGRYTLGKTAIEVIELSRHLYR"
     MYSNHNEIRS KLALLQLAKE LGSISKACDM MGYSRDSYYR FKKQYENAGE QGLHNLSRKK        60
     STLKNRVSQE VEDQVIEIAL DYPNYGQAKV AELLTARGCT ISPSGVRTIW LRHNLETKQN       120
     RLIALNSRLR QQNELDFNAQ HQIEKSCKLQ QEEGSLDCQG PGDICVQDTF KIGNIPGLGT       180
     VYQHTCMDAY SQYTHAHITL EKSSTISSDF LRTQVLPWYK NQYIPINSIL TDRGAEFSGK       240
     YSQQFQNLLQ QTAINHIQKR AYNGPIVNGI AARFHNLAHS EFYAPFLKNN KVSNIETLNE       300
     NLQKWLKRYN HQYAIAGRYT LGKTAIEVIE LSRHLYR                                337
//

If you have problems or comments...

PBIL Back to PBIL home page