(data stored in ACNUC7421 zone)

EMBL: CP000821.PE364

CP000821.PE364       Location/Qualifiers
FT   CDS             427389..428024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0364"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sfr:Sfri_3880 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34977"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ54"
FT                   /protein_id="ABV34977.1"
FT                   /translation="MSELKIGEISKPRFEFRTFGQDFSVAAERMARLSVPVPEKVWRRE
FT                   SDEIYIMSRTNDLNNTKIRDGKMDVKAYVQTVNGLEQWDPKLKAEFPISKTQLVEEIFP
FT                   AFMVEIPALAKQEYSFEEFISIIDAHPDLQAVKIHKERYGYMVNNTICEVANVLVNGAS
FT                   LVSVNSESVELDDIQRTVSDLRLEGVENINYLQAIKRVIGMKNLPLAN"
     MSELKIGEIS KPRFEFRTFG QDFSVAAERM ARLSVPVPEK VWRRESDEIY IMSRTNDLNN        60
     TKIRDGKMDV KAYVQTVNGL EQWDPKLKAE FPISKTQLVE EIFPAFMVEI PALAKQEYSF       120
     EEFISIIDAH PDLQAVKIHK ERYGYMVNNT ICEVANVLVN GASLVSVNSE SVELDDIQRT       180
     VSDLRLEGVE NINYLQAIKR VIGMKNLPLA N                                      211
//

If you have problems or comments...

PBIL Back to PBIL home page