(data stored in ACNUC7421 zone)

EMBL: CP000821.PE366

CP000821.PE366       Location/Qualifiers
FT   CDS             428526..429851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0366"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ppr:PBPRA2016 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34979"
FT                   /db_xref="GOA:A8FQ56"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ56"
FT                   /protein_id="ABV34979.1"
FT                   /translation="MLSLSIADQYHLKISVEIPPEQQSLQWKVFFFFPAKLVQHSDSMS
FT                   SALFYRNLLQQQKLVKLEAVTHQGVKHDLLILRKTAYAVAKVNKTLYRSALADFVAASL
FT                   EMLTEKSDEELLDFARYLDKFHQIHDDEEHLSQRKLFKLADHLLLYHYHQALLKAKHSA
FT                   IKEEKAQYSLRIKNLTAYAESENHKLTHDSEFGREKLLDRLQLAQRILNRPYQLRRKML
FT                   NSGMLAEQLIFGFAAAFAMAFATAAAFMTQKAFGNFSTPFFFSLVLSYIFKDRIKELGR
FT                   NYLMEKYFAHYFQHHYRFYKGSDSEVVFDAKETLYRLNSENIKDLLKKVRKAFSSSDSN
FT                   AFKEALVYQRSYTAHVKKQQLVSAKFVDNLTLNLSGRLRSLPRVIRRHWKEADRNIQAV
FT                   NVEQIHPVYLAFEVKTDSGISHKIYKLTASRKGIHALVEAVE"
     MLSLSIADQY HLKISVEIPP EQQSLQWKVF FFFPAKLVQH SDSMSSALFY RNLLQQQKLV        60
     KLEAVTHQGV KHDLLILRKT AYAVAKVNKT LYRSALADFV AASLEMLTEK SDEELLDFAR       120
     YLDKFHQIHD DEEHLSQRKL FKLADHLLLY HYHQALLKAK HSAIKEEKAQ YSLRIKNLTA       180
     YAESENHKLT HDSEFGREKL LDRLQLAQRI LNRPYQLRRK MLNSGMLAEQ LIFGFAAAFA       240
     MAFATAAAFM TQKAFGNFST PFFFSLVLSY IFKDRIKELG RNYLMEKYFA HYFQHHYRFY       300
     KGSDSEVVFD AKETLYRLNS ENIKDLLKKV RKAFSSSDSN AFKEALVYQR SYTAHVKKQQ       360
     LVSAKFVDNL TLNLSGRLRS LPRVIRRHWK EADRNIQAVN VEQIHPVYLA FEVKTDSGIS       420
     HKIYKLTASR KGIHALVEAV E                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page