(data stored in ACNUC7421 zone)

EMBL: CP000821.PE369

CP000821.PE369       Location/Qualifiers
FT   CDS             432396..433064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0369"
FT                   /product="protein of unknown function DUF47"
FT                   /note="KEGG: sfr:Sfri_3884 protein of unknown function
FT                   DUF47"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34982"
FT                   /db_xref="InterPro:IPR002727"
FT                   /db_xref="InterPro:IPR018445"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ59"
FT                   /protein_id="ABV34982.1"
FT                   /translation="MFGFSRVTSLLSQSKSTEASIYTFLEQVTLSHHAFVQLWKAYLRH
FT                   GADSEEFKSTLDELQRIEQHADNLKREIENTLYRKTLIPDLRSDVASLIELTDRLINKQ
FT                   ETIGLHLDIEKPLIPVEVEEDLLLLLNVVGDTIDHALLCAKSFFTDLQRVQEYHKKTIM
FT                   FESDADKVCTRAKTILFETDQPLINKVQLRYFFDRIDQVANLAEDISDRISIFTLKRVQ
FT                   "
     MFGFSRVTSL LSQSKSTEAS IYTFLEQVTL SHHAFVQLWK AYLRHGADSE EFKSTLDELQ        60
     RIEQHADNLK REIENTLYRK TLIPDLRSDV ASLIELTDRL INKQETIGLH LDIEKPLIPV       120
     EVEEDLLLLL NVVGDTIDHA LLCAKSFFTD LQRVQEYHKK TIMFESDADK VCTRAKTILF       180
     ETDQPLINKV QLRYFFDRID QVANLAEDIS DRISIFTLKR VQ                          222
//

If you have problems or comments...

PBIL Back to PBIL home page