(data stored in ACNUC7421 zone)

EMBL: CP000821.PE37

CP000821.PE37        Location/Qualifiers
FT   CDS             43565..44671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0037"
FT                   /product="DNA protecting protein DprA"
FT                   /note="KEGG: slo:Shew_3734 DNA protecting protein DprA"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34650"
FT                   /db_xref="GOA:A8FP77"
FT                   /db_xref="InterPro:IPR003488"
FT                   /db_xref="InterPro:IPR041614"
FT                   /db_xref="UniProtKB/TrEMBL:A8FP77"
FT                   /protein_id="ABV34650.1"
FT                   /translation="MITEKLVDWLVVSAVSGLGPARIQQLLNYMDVEELRQRLEHEKDA
FT                   LPLPESLLKRELAPDFSLVDSALDWLQSSSHHHIVTLDDPHYPNLLKQISDPPSILFIK
FT                   GEPDTLLLPSIAVVGSRAATSAGLQSAYQLAGELGSIGFSVSSGMAAGVDGAAHQACID
FT                   NSAKTIAVLGTGVEVIYPRRHKKLYEKIQCHGAVISEFWPDVKPYAGNFPKRNRIISGL
FT                   SLGTLVVEACRRSGSLITARLALEQGREVFAVPGNILGGQSQGCHDLLRDGAKLVENAA
FT                   DIIEEVSVLCDFHLEELKSRHHIGGENASDLPFTSLLASVGYETTPIDVVVEHSGKAIE
FT                   LVLEQMLELELQGWVAVVPGGYVRLRRS"
     MITEKLVDWL VVSAVSGLGP ARIQQLLNYM DVEELRQRLE HEKDALPLPE SLLKRELAPD        60
     FSLVDSALDW LQSSSHHHIV TLDDPHYPNL LKQISDPPSI LFIKGEPDTL LLPSIAVVGS       120
     RAATSAGLQS AYQLAGELGS IGFSVSSGMA AGVDGAAHQA CIDNSAKTIA VLGTGVEVIY       180
     PRRHKKLYEK IQCHGAVISE FWPDVKPYAG NFPKRNRIIS GLSLGTLVVE ACRRSGSLIT       240
     ARLALEQGRE VFAVPGNILG GQSQGCHDLL RDGAKLVENA ADIIEEVSVL CDFHLEELKS       300
     RHHIGGENAS DLPFTSLLAS VGYETTPIDV VVEHSGKAIE LVLEQMLELE LQGWVAVVPG       360
     GYVRLRRS                                                                368
//

If you have problems or comments...

PBIL Back to PBIL home page