(data stored in ACNUC7421 zone)

EMBL: CP000821.PE371

CP000821.PE371       Location/Qualifiers
FT   CDS             435056..436882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0371"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sfr:Sfri_3883 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34984"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ61"
FT                   /protein_id="ABV34984.1"
FT                   /translation="MRSHLLALSVLPFAFSAIASSSLDALYGPIMPPAYIKAYEVNNHH
FT                   QIALNPYLQVGNADNPIILDEGEGYVWVIDKDGNFVIAPEVTSPWGRKYKEGMMRIEDG
FT                   KPKKWGYKEKYGHTALIGGSKARIGGELEMENGQWIMNNKSGRYNKRRPGRTEEAMHNA
FT                   GDLLIAIAPQIAELDYEYLKDYGPAKPISLKVMKDIEWHYMIDDDYFWDAEGKKLGKAF
FT                   VEKTPFIDWRAKVKFKEGFYMDTQDRFLKSQDEIFRVRLDVSKPRKSKFTHKLRSSDIT
FT                   DLKPMIDGEGEVDVSIGGDLYSLATDTGFNFLNFDFYNANSEEIFEYLMFADRRAYKQM
FT                   TPLMRYGADKVLKTDIMRQSKYKGWLNTGPFAGHEIEIQIWKKIIEPGKFGKEGKYSEP
FT                   LLLEIGFEGKTKNREELNKLNTWLYGKLKSADLLAKDQSQSKTEIAFAVSKRFDAKKTP
FT                   KLPQVAPEVKIAAIDGIKTRNLDGTINVKTNGDKQVIAGQKGVQGEVYQTALNGKPLSV
FT                   VVLGGKGNIKQALAKVVGAKGELLVAVAAGSSLDNPKSRAKLAAKLDGGNALKGYELLG
FT                   DTARDYLKPIIKKNMDIKARSNQHYYWSGVAE"
     MRSHLLALSV LPFAFSAIAS SSLDALYGPI MPPAYIKAYE VNNHHQIALN PYLQVGNADN        60
     PIILDEGEGY VWVIDKDGNF VIAPEVTSPW GRKYKEGMMR IEDGKPKKWG YKEKYGHTAL       120
     IGGSKARIGG ELEMENGQWI MNNKSGRYNK RRPGRTEEAM HNAGDLLIAI APQIAELDYE       180
     YLKDYGPAKP ISLKVMKDIE WHYMIDDDYF WDAEGKKLGK AFVEKTPFID WRAKVKFKEG       240
     FYMDTQDRFL KSQDEIFRVR LDVSKPRKSK FTHKLRSSDI TDLKPMIDGE GEVDVSIGGD       300
     LYSLATDTGF NFLNFDFYNA NSEEIFEYLM FADRRAYKQM TPLMRYGADK VLKTDIMRQS       360
     KYKGWLNTGP FAGHEIEIQI WKKIIEPGKF GKEGKYSEPL LLEIGFEGKT KNREELNKLN       420
     TWLYGKLKSA DLLAKDQSQS KTEIAFAVSK RFDAKKTPKL PQVAPEVKIA AIDGIKTRNL       480
     DGTINVKTNG DKQVIAGQKG VQGEVYQTAL NGKPLSVVVL GGKGNIKQAL AKVVGAKGEL       540
     LVAVAAGSSL DNPKSRAKLA AKLDGGNALK GYELLGDTAR DYLKPIIKKN MDIKARSNQH       600
     YYWSGVAE                                                                608
//

If you have problems or comments...

PBIL Back to PBIL home page