(data stored in ACNUC7421 zone)

EMBL: CP000821.PE373

CP000821.PE373       Location/Qualifiers
FT   CDS             438266..438928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0373"
FT                   /product="Adenylate kinase"
FT                   /EC_number="2.7.4.3"
FT                   /note="KEGG: slo:Shew_2230 adenylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34986"
FT                   /db_xref="GOA:A8FQ63"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR007862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ63"
FT                   /protein_id="ABV34986.1"
FT                   /translation="MRIMLLGAPGVGKGTQAQFIMEKYGIPQISTGDMLRAAVKAQSPL
FT                   GLEAKLLMDSGQLVSDNLIIGLVKERIVQDDCAKGFLLDGFPRTLPQADAMVANGIDID
FT                   HVVEIDVPDEEIVKRMGGRRIHPGSGRVYHTVFKQPKVEGKDDLTGEALIIRADDEEST
FT                   VRSRLDIYHQQTKPLVKYYGKLADFGKLTYNKFDGTQSVADVSAAIVKAHQAFAPSI"
     MRIMLLGAPG VGKGTQAQFI MEKYGIPQIS TGDMLRAAVK AQSPLGLEAK LLMDSGQLVS        60
     DNLIIGLVKE RIVQDDCAKG FLLDGFPRTL PQADAMVANG IDIDHVVEID VPDEEIVKRM       120
     GGRRIHPGSG RVYHTVFKQP KVEGKDDLTG EALIIRADDE ESTVRSRLDI YHQQTKPLVK       180
     YYGKLADFGK LTYNKFDGTQ SVADVSAAIV KAHQAFAPSI                             220
//

If you have problems or comments...

PBIL Back to PBIL home page