(data stored in ACNUC7421 zone)

EMBL: CP000821.PE374

CP000821.PE374       Location/Qualifiers
FT   CDS             complement(439043..439681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0374"
FT                   /product="ERCC4 domain protein"
FT                   /note="KEGG: spc:Sputcn32_3619 ERCC4 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34987"
FT                   /db_xref="GOA:A8FQ64"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR006166"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ64"
FT                   /protein_id="ABV34987.1"
FT                   /translation="MNKTLIEIAYDDREHAEILIEQLSLHTELCLVRKRLKLGDYQINN
FT                   WLIERKTLPDLVFSLCNGRLFSQIARLSKCSDNAALLIEGSSKDIASYDITREALIGAL
FT                   CSISINFNIPILRSLSQYESAKILYFCATQLNSRETGLKLNGRKPKRRKNRQLFILQSL
FT                   PEVGPRLARRLLKHFDSVEAVITASTDELIKVEGIGQERARKIREMLIP"
     MNKTLIEIAY DDREHAEILI EQLSLHTELC LVRKRLKLGD YQINNWLIER KTLPDLVFSL        60
     CNGRLFSQIA RLSKCSDNAA LLIEGSSKDI ASYDITREAL IGALCSISIN FNIPILRSLS       120
     QYESAKILYF CATQLNSRET GLKLNGRKPK RRKNRQLFIL QSLPEVGPRL ARRLLKHFDS       180
     VEAVITASTD ELIKVEGIGQ ERARKIREML IP                                     212
//

If you have problems or comments...

PBIL Back to PBIL home page