(data stored in ACNUC7421 zone)

EMBL: CP000821.PE375

CP000821.PE375       Location/Qualifiers
FT   CDS             complement(439843..441147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0375"
FT                   /product="HipA domain protein"
FT                   /note="KEGG: she:Shewmr4_3395 HipA domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34988"
FT                   /db_xref="InterPro:IPR012893"
FT                   /db_xref="InterPro:IPR017508"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ65"
FT                   /protein_id="ABV34988.1"
FT                   /translation="MSGSNFHILEMHFRGMVIGAIGFDIDTEQFSIEYTKPWQEKGFPI
FT                   SPRLPLDGQASSSQISIYLTNLLPENKGLDHLIEALGIAKSNTFGLIKGIGFDTSGAIL
FT                   YLPVGTKPPATSFTPICKEDLIKRIEDPEHWPMEVWDGKPRLSVAGVQSKLNLFHSDKE
FT                   YGFGEGELCSTHIIKFEKNNQHLVLNEFITMTLAGLIGMQVAKVDIMPIGKYKALSVTR
FT                   FDRMYEPERHIVMRRHQIDVCQALGFSVSRKYERNFGSGRDVQDIREGVSLERLFSIAE
FT                   HCANPAQAKFDMLRWTIFNLLVCNADSHGKNYSFYVTPDGLEPTPWYDLVNVQMYPDFD
FT                   QELAMAIGDEFEADKIHAYQLMTFAEECGIKQNILELSLKQLAKAIIGNLDKAAKQTGE
FT                   ITDAESKYVETYKKTIQARCEYYLAQVEEMKHIKL"
     MSGSNFHILE MHFRGMVIGA IGFDIDTEQF SIEYTKPWQE KGFPISPRLP LDGQASSSQI        60
     SIYLTNLLPE NKGLDHLIEA LGIAKSNTFG LIKGIGFDTS GAILYLPVGT KPPATSFTPI       120
     CKEDLIKRIE DPEHWPMEVW DGKPRLSVAG VQSKLNLFHS DKEYGFGEGE LCSTHIIKFE       180
     KNNQHLVLNE FITMTLAGLI GMQVAKVDIM PIGKYKALSV TRFDRMYEPE RHIVMRRHQI       240
     DVCQALGFSV SRKYERNFGS GRDVQDIREG VSLERLFSIA EHCANPAQAK FDMLRWTIFN       300
     LLVCNADSHG KNYSFYVTPD GLEPTPWYDL VNVQMYPDFD QELAMAIGDE FEADKIHAYQ       360
     LMTFAEECGI KQNILELSLK QLAKAIIGNL DKAAKQTGEI TDAESKYVET YKKTIQARCE       420
     YYLAQVEEMK HIKL                                                         434
//

If you have problems or comments...

PBIL Back to PBIL home page