(data stored in ACNUC7421 zone)

EMBL: CP000821.PE377

CP000821.PE377       Location/Qualifiers
FT   CDS             complement(441797..442660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0377"
FT                   /product="YicC N-terminal domain protein"
FT                   /note="KEGG: slo:Shew_3489 YicC N-terminal domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34990"
FT                   /db_xref="InterPro:IPR005229"
FT                   /db_xref="InterPro:IPR013527"
FT                   /db_xref="InterPro:IPR013551"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ67"
FT                   /protein_id="ABV34990.1"
FT                   /translation="MIQSMTAYARIEHKAEWGTASWEIRSVNQRYLETYLRLPEHFRNL
FT                   EPVLRDRLRKRLNRGKIEVNLRYDLADNSSNELQINQDLAKQLINAANWVKEEAGQGEL
FT                   NLVDILKWPGVMSGSEQDMDALGKELLVAFDSAIDQFIEARGREGAAINTMLQTRLDAI
FT                   VEQVTIVREHMPTVMQWQRDKLINRLAEITGELDPARMEQEMVILAQKMDVAEEMDRLD
FT                   AHVAETQRILKKGGAQGRRLDFMMQEFNRESNTLASKSISAEVTAAAVELKVLIEQMRE
FT                   QIQNVE"
     MIQSMTAYAR IEHKAEWGTA SWEIRSVNQR YLETYLRLPE HFRNLEPVLR DRLRKRLNRG        60
     KIEVNLRYDL ADNSSNELQI NQDLAKQLIN AANWVKEEAG QGELNLVDIL KWPGVMSGSE       120
     QDMDALGKEL LVAFDSAIDQ FIEARGREGA AINTMLQTRL DAIVEQVTIV REHMPTVMQW       180
     QRDKLINRLA EITGELDPAR MEQEMVILAQ KMDVAEEMDR LDAHVAETQR ILKKGGAQGR       240
     RLDFMMQEFN RESNTLASKS ISAEVTAAAV ELKVLIEQMR EQIQNVE                     287
//

If you have problems or comments...

PBIL Back to PBIL home page