(data stored in ACNUC7421 zone)

EMBL: CP000821.PE38

CP000821.PE38        Location/Qualifiers
FT   CDS             44674..45147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0038"
FT                   /product="protein of unknown function DUF494"
FT                   /note="KEGG: slo:Shew_3733 protein of unknown function
FT                   DUF494"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34651"
FT                   /db_xref="InterPro:IPR007456"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8FP78"
FT                   /protein_id="ABV34651.1"
FT                   /translation="MFDILMYLFENYVHSEVEFLVDEDELTQELTRAGFHQSEIIKALS
FT                   WLENLAELQEGDTPYLCDHDQHSFRIYTQKEMDKLDVECRGFLLFLEQIKVLSVETREM
FT                   VIDRVMELDETALILEDLKWVVLMVLFNAPGNESAYEQMEDLIFEQPDGRLHS"
     MFDILMYLFE NYVHSEVEFL VDEDELTQEL TRAGFHQSEI IKALSWLENL AELQEGDTPY        60
     LCDHDQHSFR IYTQKEMDKL DVECRGFLLF LEQIKVLSVE TREMVIDRVM ELDETALILE       120
     DLKWVVLMVL FNAPGNESAY EQMEDLIFEQ PDGRLHS                                157
//

If you have problems or comments...

PBIL Back to PBIL home page