(data stored in ACNUC7421 zone)

EMBL: CP000821.PE381

CP000821.PE381       Location/Qualifiers
FT   CDS             complement(445480..447444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0381"
FT                   /product="peptidase S9, prolyl oligopeptidase active site
FT                   domain protein"
FT                   /note="KEGG: slo:Shew_3485 peptidase S9, prolyl
FT                   oligopeptidase active site domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34994"
FT                   /db_xref="GOA:A8FQ71"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002470"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ71"
FT                   /protein_id="ABV34994.1"
FT                   /translation="MKLIKFFSFACLTILSYNAVAKIESPAEVFSRSAEFSNVKISPGG
FT                   DYLSTITTKDGKQVLIILDAKTRKPLHSVYFSTNAQVGDYQWVNDERVVLQKVYLKGWQ
FT                   DHPLYYGELMAVNADGSKPVYLFGYAQKGQQTGTRIKKNTPIRATAYILDPMPENKRYM
FT                   LVKALPWGSGSSNTAENLQQVYRVDVYKGKRKKLVTSPISYANFLTDDEGEVRFVSGTR
FT                   DYINSRLFYREDNLWVDTDKLQLNLEQMRPIAFGDDKDSVYVVGSEPGKNKGIYLINIK
FT                   TGTKKLVSRDDVVDPYNVWINQNNKKLYAVEFENGYPSYEFVDKQDARAKLIKQLLASL
FT                   PGHQIHLVSETTDANQFIIKAFNDRNPGDYYLFNTETMKLEYLVSQKNWLDPELMAEVK
FT                   PISFTSRDGKKIHGYLTLPNNIEAKNLPLVVNPHGGPHGPRDWWGFDAQNQLIASQGAA
FT                   ILQINFRGSGGYGKEFEHLGHQKWGTDIQYDIIDGTKYVIEQGLVDKDRICIAGGSFGG
FT                   YSALMAPTLAPDMFKCAIGFAGVYDLPLMFKEGDVQSRRAGERYLEKVLGEDTKVLQSM
FT                   SPTHNVDKLKTKLLLVHGGDDERAPIEQFEALEDALNERNYPYQKLIMDDEGHGFYNDD
FT                   HQAKYYGEMLSFLKENLKL"
     MKLIKFFSFA CLTILSYNAV AKIESPAEVF SRSAEFSNVK ISPGGDYLST ITTKDGKQVL        60
     IILDAKTRKP LHSVYFSTNA QVGDYQWVND ERVVLQKVYL KGWQDHPLYY GELMAVNADG       120
     SKPVYLFGYA QKGQQTGTRI KKNTPIRATA YILDPMPENK RYMLVKALPW GSGSSNTAEN       180
     LQQVYRVDVY KGKRKKLVTS PISYANFLTD DEGEVRFVSG TRDYINSRLF YREDNLWVDT       240
     DKLQLNLEQM RPIAFGDDKD SVYVVGSEPG KNKGIYLINI KTGTKKLVSR DDVVDPYNVW       300
     INQNNKKLYA VEFENGYPSY EFVDKQDARA KLIKQLLASL PGHQIHLVSE TTDANQFIIK       360
     AFNDRNPGDY YLFNTETMKL EYLVSQKNWL DPELMAEVKP ISFTSRDGKK IHGYLTLPNN       420
     IEAKNLPLVV NPHGGPHGPR DWWGFDAQNQ LIASQGAAIL QINFRGSGGY GKEFEHLGHQ       480
     KWGTDIQYDI IDGTKYVIEQ GLVDKDRICI AGGSFGGYSA LMAPTLAPDM FKCAIGFAGV       540
     YDLPLMFKEG DVQSRRAGER YLEKVLGEDT KVLQSMSPTH NVDKLKTKLL LVHGGDDERA       600
     PIEQFEALED ALNERNYPYQ KLIMDDEGHG FYNDDHQAKY YGEMLSFLKE NLKL             654
//

If you have problems or comments...

PBIL Back to PBIL home page