(data stored in ACNUC7421 zone)

EMBL: CP000821.PE385

CP000821.PE385       Location/Qualifiers
FT   CDS             450403..451080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0385"
FT                   /product="DNA repair protein RadC"
FT                   /note="KEGG: sbl:Sbal_0377 DNA repair protein RadC"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34998"
FT                   /db_xref="GOA:A8FQ75"
FT                   /db_xref="InterPro:IPR001405"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR020891"
FT                   /db_xref="InterPro:IPR025657"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8FQ75"
FT                   /protein_id="ABV34998.1"
FT                   /translation="MGIKDWPDGEGPREKLLKLGVGPLSDAELLAVVLRNGVQGLSAVE
FT                   LARNLIGQFGGLRELLTASEIEVCRMPGMGPVKFAQLQAAAELSKRISQQNLKRGKILS
FT                   DPDLTRDYLMRQLADRAYEVFAILLLDSQHRVIQFVELFRGTIDSASVYPRDVVCLVLE
FT                   KKAAAVIVCHNHPSGVAEPSLADRRITERLKFALETIDVSLLDHMVVGDREIVSFAERG
FT                   WID"
     MGIKDWPDGE GPREKLLKLG VGPLSDAELL AVVLRNGVQG LSAVELARNL IGQFGGLREL        60
     LTASEIEVCR MPGMGPVKFA QLQAAAELSK RISQQNLKRG KILSDPDLTR DYLMRQLADR       120
     AYEVFAILLL DSQHRVIQFV ELFRGTIDSA SVYPRDVVCL VLEKKAAAVI VCHNHPSGVA       180
     EPSLADRRIT ERLKFALETI DVSLLDHMVV GDREIVSFAE RGWID                       225
//

If you have problems or comments...

PBIL Back to PBIL home page