(data stored in ACNUC7421 zone)

EMBL: CP000821.PE387

CP000821.PE387       Location/Qualifiers
FT   CDS             451451..451624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0387"
FT                   /product="ribosomal protein L33"
FT                   /note="KEGG: sfr:Sfri_3826 ribosomal protein L33"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35000"
FT                   /db_xref="GOA:A8FQ77"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018264"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8FQ77"
FT                   /protein_id="ABV35000.1"
FT                   /translation="MAKSKGNREKIKLVSSAKTGHFYTTEKNKRNMPEKMEIKKFDPVI
FT                   RQHVMYKEAKIK"
     MAKSKGNREK IKLVSSAKTG HFYTTEKNKR NMPEKMEIKK FDPVIRQHVM YKEAKIK           57
//

If you have problems or comments...

PBIL Back to PBIL home page