(data stored in ACNUC7421 zone)

EMBL: CP000821.PE389

CP000821.PE389       Location/Qualifiers
FT   CDS             complement(453603..454499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0389"
FT                   /product="rarD protein"
FT                   /note="KEGG: son:SO4243 rarD protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35002"
FT                   /db_xref="GOA:A8FQ79"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="InterPro:IPR004626"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ79"
FT                   /protein_id="ABV35002.1"
FT                   /translation="MLDSEHRKGIAFALCAYTLWGFAALYFKLLDHVSATEILIHRVIW
FT                   SFVFVTMLMFIFGGFSRLRQVLKRPKQLAVLTLTSVLIAGNWLLFIWAVNNDHMLDASL
FT                   GYFINPLVNVMLGMVFLSERLRKLQWCAVALAGAGVLVQLISFGSIPLVSLGLAFSFGL
FT                   YGLLRKKVNVDAKTGLLVETAILFPIAMIYLFANMGDALTNLMTNTLSNNLLLMAAGIV
FT                   TTIPLLCFAAAAVRIPLSMLGFFQYIGPSIMFILAVTLYKEPFDLEKGITFAFIWSALI
FT                   LFSIDMLYKRKKPLRES"
     MLDSEHRKGI AFALCAYTLW GFAALYFKLL DHVSATEILI HRVIWSFVFV TMLMFIFGGF        60
     SRLRQVLKRP KQLAVLTLTS VLIAGNWLLF IWAVNNDHML DASLGYFINP LVNVMLGMVF       120
     LSERLRKLQW CAVALAGAGV LVQLISFGSI PLVSLGLAFS FGLYGLLRKK VNVDAKTGLL       180
     VETAILFPIA MIYLFANMGD ALTNLMTNTL SNNLLLMAAG IVTTIPLLCF AAAAVRIPLS       240
     MLGFFQYIGP SIMFILAVTL YKEPFDLEKG ITFAFIWSAL ILFSIDMLYK RKKPLRES         298
//

If you have problems or comments...

PBIL Back to PBIL home page