(data stored in ACNUC7421 zone)

EMBL: CP000821.PE390

CP000821.PE390       Location/Qualifiers
FT   CDS             complement(454745..455209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0390"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shw:Sputw3181_0371 uncharacterized domain 1"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35003"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ80"
FT                   /protein_id="ABV35003.1"
FT                   /translation="MTNPIQEQTLRRVAEVFDKQVPFHNLLGLDIKRYDLDGVEVVINM
FT                   KPELIGNIHQQILHGGVTATVLDVVGGLTVFAGLVASREDWSIEDLQSRLQTLGTIDLR
FT                   VDYLRPGRGMQFTGTGTVIRAGNRVSVCRMELHNEQGSHIAFGTGTYMVG"
     MTNPIQEQTL RRVAEVFDKQ VPFHNLLGLD IKRYDLDGVE VVINMKPELI GNIHQQILHG        60
     GVTATVLDVV GGLTVFAGLV ASREDWSIED LQSRLQTLGT IDLRVDYLRP GRGMQFTGTG       120
     TVIRAGNRVS VCRMELHNEQ GSHIAFGTGT YMVG                                   154
//

If you have problems or comments...

PBIL Back to PBIL home page