(data stored in ACNUC7421 zone)

EMBL: CP000821.PE392

CP000821.PE392       Location/Qualifiers
FT   CDS             complement(457338..459089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0392"
FT                   /product="response regulator receiver protein"
FT                   /note="KEGG: slo:Shew_3473 response regulator receiver
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35005"
FT                   /db_xref="GOA:A8FQ82"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ82"
FT                   /protein_id="ABV35005.1"
FT                   /translation="MDFRIVVLSLTFWLAPVWASTSVPLDTIDTLIYQYPSAALIEIND
FT                   LEAISSPVKLSETEKLRLALFRCETFLQLGENEAAINLARISEAKAKILKLEQARPYFL
FT                   NCMAGAFTNYGDFRQALPILDSSILLSRELKQPQSLVNGLRLRGIIDTQVDSYSSAFED
FT                   LSLAIDIYPDAQNQEQGWTLPPLIYIQIPLSKLLAKKTKIRQAFEIIERAADSKEFQGK
FT                   VRVVLTTHMAKMAQLNQYSSSDNLIQQAKTLLPELGTAFELAISYTEMAQLEYKRKNFI
FT                   RAIQLLEISLNTFKKQKKTIEELRAQRLLGEVLLASGNTDKALKLINKSISAGLRTSHY
FT                   AELILSYQVLGSYYASIGDFKQAHLYQLKRFDAAENSFNFIKDTRLLQLNARVSRQQQV
FT                   FKTELLQSNSSINVGQGFKSGYIAILLTLLFGFILGVITIRYKKRTIQAPLAIEPQSRE
FT                   HKIERLISNSKQAGYPLSLVVIHTADVYQTNLPLLISRIENLLRDQDLVINREDGELLL
FT                   LLPHTKEGGTLRVIEQIKEIITPLLNGNKTKIGYARMQQHDSLSSLIKRAHIQQLRQTK
FT                   IDKEPTG"
     MDFRIVVLSL TFWLAPVWAS TSVPLDTIDT LIYQYPSAAL IEINDLEAIS SPVKLSETEK        60
     LRLALFRCET FLQLGENEAA INLARISEAK AKILKLEQAR PYFLNCMAGA FTNYGDFRQA       120
     LPILDSSILL SRELKQPQSL VNGLRLRGII DTQVDSYSSA FEDLSLAIDI YPDAQNQEQG       180
     WTLPPLIYIQ IPLSKLLAKK TKIRQAFEII ERAADSKEFQ GKVRVVLTTH MAKMAQLNQY       240
     SSSDNLIQQA KTLLPELGTA FELAISYTEM AQLEYKRKNF IRAIQLLEIS LNTFKKQKKT       300
     IEELRAQRLL GEVLLASGNT DKALKLINKS ISAGLRTSHY AELILSYQVL GSYYASIGDF       360
     KQAHLYQLKR FDAAENSFNF IKDTRLLQLN ARVSRQQQVF KTELLQSNSS INVGQGFKSG       420
     YIAILLTLLF GFILGVITIR YKKRTIQAPL AIEPQSREHK IERLISNSKQ AGYPLSLVVI       480
     HTADVYQTNL PLLISRIENL LRDQDLVINR EDGELLLLLP HTKEGGTLRV IEQIKEIITP       540
     LLNGNKTKIG YARMQQHDSL SSLIKRAHIQ QLRQTKIDKE PTG                         583
//

If you have problems or comments...

PBIL Back to PBIL home page