(data stored in ACNUC7421 zone)

EMBL: CP000821.PE395

CP000821.PE395       Location/Qualifiers
FT   CDS             462332..463732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0395"
FT                   /product="3-isopropylmalate dehydratase"
FT                   /EC_number="4.2.1.33"
FT                   /note="KEGG: slo:Shew_3470 3-isopropylmalate dehydratase,
FT                   large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35008"
FT                   /db_xref="GOA:A8FQ85"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004430"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8FQ85"
FT                   /protein_id="ABV35008.1"
FT                   /translation="MAKTLYEKVWDSHVVVENEGQAPLIYVDRHLVHEVTSPQAFSGLK
FT                   VAGRKLRAPEKTFATMDHNTSTKSASLDALSPMARIQVETLQDNCKEFGVRLYDIHHKN
FT                   QGIVHVMGPELGITLPGTVIVCGDSHTATHGAFGALAFGIGTSEVEHVMATQTLRQNKA
FT                   KTMKIEVRGHVAAGITAKDIVLAIIGKIGMDGGTGYVVEFCGEAIEALSMEGRMTVCNM
FT                   AIEMGAKAGMVAPDGITAEYLKGREFAPKGESWEQAIAAWAELKTDEDAIFDASVVLEA
FT                   SDIAPQLTWGTNPGQVVAIDGLVPNPEDESNATVKASIEKALEYVALSAGTCMTDVSIN
FT                   KVFIGSCTNSRIEDLRDAALHAKGRKVAAGVTAIVVPGSGLVKEQAEAEGLDKIFLEAG
FT                   FEWRLPGCSMCLAMNDDRLEAGDRCASTSNRNFEGRQGRGSRTHLVSPAMAAAAAVAGH
FT                   FVDIRKAY"
     MAKTLYEKVW DSHVVVENEG QAPLIYVDRH LVHEVTSPQA FSGLKVAGRK LRAPEKTFAT        60
     MDHNTSTKSA SLDALSPMAR IQVETLQDNC KEFGVRLYDI HHKNQGIVHV MGPELGITLP       120
     GTVIVCGDSH TATHGAFGAL AFGIGTSEVE HVMATQTLRQ NKAKTMKIEV RGHVAAGITA       180
     KDIVLAIIGK IGMDGGTGYV VEFCGEAIEA LSMEGRMTVC NMAIEMGAKA GMVAPDGITA       240
     EYLKGREFAP KGESWEQAIA AWAELKTDED AIFDASVVLE ASDIAPQLTW GTNPGQVVAI       300
     DGLVPNPEDE SNATVKASIE KALEYVALSA GTCMTDVSIN KVFIGSCTNS RIEDLRDAAL       360
     HAKGRKVAAG VTAIVVPGSG LVKEQAEAEG LDKIFLEAGF EWRLPGCSMC LAMNDDRLEA       420
     GDRCASTSNR NFEGRQGRGS RTHLVSPAMA AAAAVAGHFV DIRKAY                      466
//

If you have problems or comments...

PBIL Back to PBIL home page