(data stored in ACNUC7421 zone)

EMBL: CP000821.PE396

CP000821.PE396       Location/Qualifiers
FT   CDS             463746..464351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0396"
FT                   /product="3-isopropylmalate dehydratase, small subunit"
FT                   /note="KEGG: slo:Shew_3469 3-isopropylmalate dehydratase,
FT                   small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35009"
FT                   /db_xref="GOA:A8FQ86"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR004431"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8FQ86"
FT                   /protein_id="ABV35009.1"
FT                   /translation="MNPFTSHTGLAVMIDSANVDTDQIIPKQFLSKVTRDGFGVHLFHD
FT                   WRYLDEAGDEPNPGFSLNLPRYKGASILISKENFGCGSSREHAPWALADFGLRAIIAPS
FT                   FADIFYGNSINNGLLPVRLTDVEVQQLMDEVEASEGAEITVDLEELTVTSPSGAVFNFE
FT                   IAGSARHNLLNGLDAIGLSLACADQIARYEAQLPTWKA"
     MNPFTSHTGL AVMIDSANVD TDQIIPKQFL SKVTRDGFGV HLFHDWRYLD EAGDEPNPGF        60
     SLNLPRYKGA SILISKENFG CGSSREHAPW ALADFGLRAI IAPSFADIFY GNSINNGLLP       120
     VRLTDVEVQQ LMDEVEASEG AEITVDLEEL TVTSPSGAVF NFEIAGSARH NLLNGLDAIG       180
     LSLACADQIA RYEAQLPTWK A                                                 201
//

If you have problems or comments...

PBIL Back to PBIL home page